Rabbit anti-Human PGLYRP1 Polyclonal Antibody | anti-PGLYRP1 antibody

PGLYRP1 (Peptidoglycan Recognition Protein 1, Peptidoglycan Recognition Protein Short, PGRP-S, PGLYRP, PGRP, TNFSF3L, SBBI68, MGC126894, MGC126896, UNQ639/PRO1269)

Cat. Num. AAA641189

• Gene Names: PGLYRP1; PGRP; TAG7; PGRPS; PGLYRP; PGRP-S; TNFSF3L
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: PGLYRP1; Polyclonal Antibody; PGLYRP1 (Peptidoglycan Recognition Protein 1; Peptidoglycan Recognition Protein Short; PGRP-S; PGLYRP; PGRP; TNFSF3L; SBBI68; MGC126894; MGC126896; UNQ639/PRO1269); Anti -PGLYRP1 (Peptidoglycan Recognition Protein 1; anti-PGLYRP1 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human PGLYRP1.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MSRRSMLLAWALPSLLRLGAAQETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHYRSP

• Applicable Applications for anti-PGLYRP1 antibody: Western Blot (WB)
• Application Notes: Suitable for use in Western Blot.
• Immunogen: Full length human PGLYRP1, aa1-196 (NP_005082.1).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of PGLYRP1 expression in transfected 293T cell line by PGLYRP1 polyclonal antibody. Lane 1: PGLYRP1 transfected lysate (21.7kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-PGLYRP1 antibody

The primary immune recognition is based on structures common among invading pathogens. Bacterial surface molecules, such as lipopolysaccharide (LPS) and peptidoglycan (PGN), are known to elicit immune reactions ranging from cytokine release to fever. Recently, a family of proteins called peptidoglycan recognition protein (PGRP) has been identified in mouse and human that binds to peptidoglycans expressed on Gram-positive bacteria. Peptidoglycan (PGN) is an essential cell wall component of virtually all bacteria and, thus, it is an excellent target for recognition by the eukaryotic innate immune system. The PGRPs (PGRP-L, PGRP-S, PGRP-Ia, and PGRP-Ib) define a new family of human pattern recognition molecules. PGRP-L is primarily expressed in the liver. Although liver is not considered a primary immune organ, liver participates in host defenses by producing acute phase proteins (by hepatocytes) in response to infections and by clearing microorganisms from blood. PGRP-S is present in neutrophils and inhibits growth of Gram-positive bacteria and, therefore, may function as a neutrophil antibacterial protein. However, PGRP-S may have another, as yet unidentified function because in humans it is expressed in the bone marrow 50-100 times higher than in neutrophils.

Product Categories/Family for anti-PGLYRP1 antibody

Antibodies; Abs to Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 4827036
• NCBI GeneID: 8993
• NCBI Accession #: NP_005082.1
• NCBI GenBank Nucleotide #: NM_005091.2
• UniProt Accession #: O75594; Q4VB36
• Molecular Weight: 21,731 Da
• NCBI Official Full Name: peptidoglycan recognition protein 1
• NCBI Official Synonym Full Names: peptidoglycan recognition protein 1
• NCBI Official Symbol: PGLYRP1
• NCBI Official Synonym Symbols: PGRP; TAG7; PGRPS; PGLYRP; PGRP-S; TNFSF3L
• NCBI Protein Information: peptidoglycan recognition protein 1; TNF superfamily, member 3 (LTB)-like (peptidoglycan recognition protein)
• UniProt Protein Name: Peptidoglycan recognition protein 1
• Protein Family: Peptidoglycan recognition protein
• UniProt Gene Name: PGLYRP1
• UniProt Synonym Gene Names: PGLYRP; PGRP; TNFSF3L; PGRP-S
• UniProt Entry Name: PGRP1_HUMAN

Uniprot Description

PGLYRP1: Pattern receptor that binds to murein peptidoglycans (PGN) of Gram-positive bacteria. Has bactericidal activity towards Gram-positive bacteria. May kill Gram-positive bacteria by interfering with peptidoglycan biosynthesis. Binds also to Gram- negative bacteria, and has bacteriostatic activity towards Gram- negative bacteria. Plays a role in innate immunity. Belongs to the N-acetylmuramoyl-L-alanine amidase 2 family.

Protein type: Secreted, signal peptide; Secreted; Receptor, misc.; Apoptosis

Chromosomal Location of Human Ortholog: 19q13.2-q13.3

Cellular Component: extracellular region

Molecular Function: peptidoglycan receptor activity; peptidoglycan binding; zinc ion binding; N-acetylmuramoyl-L-alanine amidase activity

Biological Process: defense response to Gram-positive bacterium; negative regulation of natural killer cell differentiation during immune response; detection of bacterium; negative regulation of interferon-gamma production; negative regulation of inflammatory response; innate immune response; immune response; pattern recognition receptor signaling pathway; peptidoglycan catabolic process