Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of PGLYRP1 expression in transfected 293T cell line by PGLYRP1 polyclonal antibody. Lane 1: PGLYRP1 transfected lysate (21.7kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human PGLYRP1 Polyclonal Antibody | anti-PGLYRP1 antibody

PGLYRP1 (Peptidoglycan Recognition Protein 1, Peptidoglycan Recognition Protein Short, PGRP-S, PGLYRP, PGRP, TNFSF3L, SBBI68, MGC126894, MGC126896, UNQ639/PRO1269) APC

Gene Names
PGLYRP1; PGRP; TAG7; PGRPS; PGLYRP; PGRP-S; TNFSF3L
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PGLYRP1; Polyclonal Antibody; PGLYRP1 (Peptidoglycan Recognition Protein 1; Peptidoglycan Recognition Protein Short; PGRP-S; PGLYRP; PGRP; TNFSF3L; SBBI68; MGC126894; MGC126896; UNQ639/PRO1269) APC; anti-PGLYRP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PGLYRP1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-PGLYRP1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human PGLYRP1, aa1-196 (NP_005082.1).
Immunogen Sequence
MSRRSMLLAWALPSLLRLGAAQETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHYRSP
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of PGLYRP1 expression in transfected 293T cell line by PGLYRP1 polyclonal antibody. Lane 1: PGLYRP1 transfected lysate (21.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PGLYRP1 expression in transfected 293T cell line by PGLYRP1 polyclonal antibody. Lane 1: PGLYRP1 transfected lysate (21.7kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-PGLYRP1 antibody
The primary immune recognition is based on structures common among invading pathogens. Bacterial surface molecules, such as lipopolysaccharide (LPS) and peptidoglycan (PGN), are known to elicit immune reactions ranging from cytokine release to fever. Recently, a family of proteins called peptidoglycan recognition protein (PGRP) has been identified in mouse and human that binds to peptidoglycans expressed on Gram-positive bacteria. Peptidoglycan (PGN) is an essential cell wall component of virtually all bacteria and, thus, it is an excellent target for recognition by the eukaryotic innate immune system. The PGRPs (PGRP-L, PGRP-S, PGRP-Ia, and PGRP-Ib) define a new family of human pattern recognition molecules. PGRP-L is primarily expressed in the liver. Although liver is not considered a primary immune organ, liver participates in host defenses by producing acute phase proteins (by hepatocytes) in response to infections and by clearing microorganisms from blood. PGRP-S is present in neutrophils and inhibits growth of Gram-positive bacteria and, therefore, may function as a neutrophil antibacterial protein. However, PGRP-S may have another, as yet unidentified function because in humans it is expressed in the bone marrow 50-100 times higher than in neutrophils.
Product Categories/Family for anti-PGLYRP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21,731 Da
NCBI Official Full Name
peptidoglycan recognition protein 1
NCBI Official Synonym Full Names
peptidoglycan recognition protein 1
NCBI Official Symbol
PGLYRP1
NCBI Official Synonym Symbols
PGRP; TAG7; PGRPS; PGLYRP; PGRP-S; TNFSF3L
NCBI Protein Information
peptidoglycan recognition protein 1; TNF superfamily, member 3 (LTB)-like (peptidoglycan recognition protein)
UniProt Protein Name
Peptidoglycan recognition protein 1
UniProt Gene Name
PGLYRP1
UniProt Synonym Gene Names
PGLYRP; PGRP; TNFSF3L; PGRP-S
UniProt Entry Name
PGRP1_HUMAN

Uniprot Description

PGLYRP1: Pattern receptor that binds to murein peptidoglycans (PGN) of Gram-positive bacteria. Has bactericidal activity towards Gram-positive bacteria. May kill Gram-positive bacteria by interfering with peptidoglycan biosynthesis. Binds also to Gram- negative bacteria, and has bacteriostatic activity towards Gram- negative bacteria. Plays a role in innate immunity. Belongs to the N-acetylmuramoyl-L-alanine amidase 2 family.

Protein type: Secreted, signal peptide; Apoptosis; Secreted; Receptor, misc.

Chromosomal Location of Human Ortholog: 19q13.2-q13.3

Cellular Component: extracellular region

Molecular Function: peptidoglycan receptor activity; peptidoglycan binding; zinc ion binding; N-acetylmuramoyl-L-alanine amidase activity

Biological Process: defense response to Gram-positive bacterium; negative regulation of natural killer cell differentiation during immune response; detection of bacterium; negative regulation of interferon-gamma production; negative regulation of inflammatory response; innate immune response; immune response; pattern recognition receptor signaling pathway; peptidoglycan catabolic process

Research Articles on PGLYRP1

Similar Products

Product Notes

The PGLYRP1 pglyrp1 (Catalog #AAA6389208) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PGLYRP1 (Peptidoglycan Recognition Protein 1, Peptidoglycan Recognition Protein Short, PGRP-S, PGLYRP, PGRP, TNFSF3L, SBBI68, MGC126894, MGC126896, UNQ639/PRO1269) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PGLYRP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PGLYRP1 pglyrp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PGLYRP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.