Mouse anti-Human POLR2H Monoclonal Antibody | anti-POLR2H antibody

POLR2H (DNA-directed RNA Polymerases I, II, and III Subunit RPABC3, DNA-directed RNA Polymerase II Subunit H, DNA-directed RNA Polymerases I, II, and III 17.1kD Polypeptide, RPB17, RPB8 Homolog) (Biotin)

Cat. Num. AAA6143655

• Gene Names: POLR2H; RPB8; RPB17; RPABC3
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: POLR2H; Monoclonal Antibody; POLR2H (DNA-directed RNA Polymerases I; II; and III Subunit RPABC3; DNA-directed RNA Polymerase II Subunit H; DNA-directed RNA Polymerases I; and III 17.1kD Polypeptide; RPB17; RPB8 Homolog) (Biotin); anti-POLR2H antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3G6-1A4
• Specificity: Recognizes human POLR2H.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-POLR2H antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-151 from human POLR2H (AAH00739) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (42.24kD).)

Western Blot (WB)

(POLR2H monoclonal antibody Western Blot analysis of POLR2H expression in Hela.)

Western Blot (WB)

(POLR2H monoclonal antibody. Western Blot analysis of POLR2H expression in HepG2.)

Western Blot (WB)

(Western Blot analysis of POLR2H expression in transfected 293T cell line by POLR2H monoclonal antibody. Lane 1: POLR2H transfected lysate (17.1kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-POLR2H antibody

This gene encodes one of the essential subunits of RNA polymerase II that is shared by the other two eukaryotic DNA-directed RNA polymerases, I and III.

Product Categories/Family for anti-POLR2H antibody

Antibodies; Enzymes; Polymerase

NCBI and Uniprot Product Information

• NCBI GI #: 33875800
• NCBI GeneID: 5437
• Molecular Weight: 9,664 Da
• NCBI Official Full Name: Homo sapiens polymerase (RNA) II (DNA directed) polypeptide H, mRNA
• NCBI Official Synonym Full Names: RNA polymerase II subunit H
• NCBI Official Symbol: POLR2H
• NCBI Official Synonym Symbols: RPB8; RPB17; RPABC3
• NCBI Protein Information: DNA-directed RNA polymerases I, II, and III subunit RPABC3

NCBI Description

The three eukaryotic RNA polymerases are complex multisubunit enzymes that play a central role in the transcription of nuclear genes. This gene encodes an essential and highly conserved subunit of RNA polymerase II that is shared by the other two eukaryotic DNA-directed RNA polymerases, I and III. Alternative splicing results in multiple transcript variants of this gene. [provided by RefSeq, Jul 2013]