Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for MBS631806 is 0.1ng/ml as a capture antibody.)

Mouse anti-Human HRH1 Monoclonal Antibody | anti-HRH1 antibody

HRH1 (Histamine H1 Receptor, H1R, HH1R) (PE)

Gene Names
HRH1; H1R; H1-R; HH1R; hisH1
Reactivity
Human
Applications
FLISA
Purity
Purified
Synonyms
HRH1; Monoclonal Antibody; HRH1 (Histamine H1 Receptor; H1R; HH1R) (PE); anti-HRH1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3D1
Specificity
Recognizes human HRH1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-HRH1 antibody
FLISA
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa312-414 from human HRH1 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQMLGDSQSFSRTDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAA
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for MBS631806 is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for MBS631806 is 0.1ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between IL6 and HRH1. HeLa cells were stained with anti-IL6 rabbit purified polyclonal (1:1200) and MBS631806 (1:50). Signals were detected by Duolink® 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between IL6 and HRH1. HeLa cells were stained with anti-IL6 rabbit purified polyclonal (1:1200) and MBS631806 (1:50). Signals were detected by Duolink® 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-HRH1 antibody
Histamine is a ubiquitous messenger molecule released from mast cells, enterochromaffin-like cells, and neurons. Its various actions are mediated by histamine receptors H1, H2, H3 and H4. This gene was thought to be intronless until recently. The protein encoded by this gene is an integral membrane protein and belongs to the G protein-coupled receptor superfamily. It mediates the contraction of smooth muscles, the increase in capillary permeability due to contraction of terminal venules, the release of catecholamine from adrenal medulla, and neurotransmission in the central nervous system. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Product Categories/Family for anti-HRH1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55,784 Da
NCBI Official Full Name
histamine H1 receptor
NCBI Official Synonym Full Names
histamine receptor H1
NCBI Official Symbol
HRH1
NCBI Official Synonym Symbols
H1R; H1-R; HH1R; hisH1
NCBI Protein Information
histamine H1 receptor; histamine receptor, subclass H1
UniProt Protein Name
Histamine H1 receptor
Protein Family
UniProt Gene Name
HRH1
UniProt Synonym Gene Names
H1R; HH1R
UniProt Entry Name
HRH1_HUMAN

Uniprot Description

H1R: In peripheral tissues, the H1 subclass of histamine receptors mediates the contraction of smooth muscles, increase in capillary permeability due to contraction of terminal venules, and catecholamine release from adrenal medulla, as well as mediating neurotransmission in the central nervous system. Belongs to the G-protein coupled receptor 1 family.

Protein type: Membrane protein, integral; Receptor, GPCR; GPCR, family 1; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 3p25

Cellular Component: nucleoplasm; integral to plasma membrane; cytoplasm; plasma membrane

Molecular Function: G-protein coupled receptor activity; histamine receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway; inositol phosphate-mediated signaling; positive regulation of vasoconstriction; eosinophil chemotaxis; regulation of synaptic plasticity; visual learning; positive regulation of inositol trisphosphate biosynthetic process; G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); regulation of vascular permeability; inflammatory response; memory

Similar Products

Product Notes

The HRH1 hrh1 (Catalog #AAA6156256) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HRH1 (Histamine H1 Receptor, H1R, HH1R) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HRH1 can be used in a range of immunoassay formats including, but not limited to, FLISA. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HRH1 hrh1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HRH1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.