Western Blot (WB)
(WB Suggested Anti-PAGE1 Antibody Titration: 5.0ug/mlPositive Control: 721_B cell lysatePAGE1 is supported by BioGPS gene expression data to be expressed in 721_B)
Rabbit anti-Human PAGE1 Polyclonal Antibody | anti-PAGE1 antibody
PAGE1 antibody - middle region
Gene Names
PAGE1; AL5; CT16.3; GAGE-9; GAGEB1; PAGE-1
Reactivity
Human
Applications
Western Blot
Purity
Protein A purified
Synonyms
PAGE1; Polyclonal Antibody; PAGE1 antibody - middle region; anti-PAGE1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TKRVCLRNEEQMKLPAEGPEPEADSQEQVHPKTGCERGDGPDVQELGLPN
Sequence Length
146
Applicable Applications for anti-PAGE1 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PAGE1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-PAGE1 Antibody Titration: 5.0ug/mlPositive Control: 721_B cell lysatePAGE1 is supported by BioGPS gene expression data to be expressed in 721_B)
Western Blot (WB)
(WB Suggested Anti-PAGE1 Antibody Titration: 5.0ug/mlPositive Control: 721_B cell lysatePAGE1 is supported by BioGPS gene expression data to be expressed in 721_B)
Related Product Information for anti-PAGE1 antibody
This is a rabbit polyclonal antibody against PAGE1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: PAGE1 belongs to a family that are expressed in a variety of tumors but not in normal tissues, except for the testis. Nothing is presently known about the function of this protein.This gene belongs to a family of genes that are expressed in a variety of tumors but not in normal tissues, except for the testis. Unlike the other gene family members, this gene does not encode an antigenic peptide. Nothing is presently known about the function of this protein.
Target Description: PAGE1 belongs to a family that are expressed in a variety of tumors but not in normal tissues, except for the testis. Nothing is presently known about the function of this protein.This gene belongs to a family of genes that are expressed in a variety of tumors but not in normal tissues, except for the testis. Unlike the other gene family members, this gene does not encode an antigenic peptide. Nothing is presently known about the function of this protein.
Product Categories/Family for anti-PAGE1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16kDa
NCBI Official Full Name
P antigen family member 1
NCBI Official Synonym Full Names
PAGE family member 1
NCBI Official Symbol
PAGE1
NCBI Official Synonym Symbols
AL5; CT16.3; GAGE-9; GAGEB1; PAGE-1
NCBI Protein Information
P antigen family member 1
UniProt Protein Name
P antigen family member 1
Protein Family
UniProt Gene Name
PAGE1
UniProt Synonym Gene Names
GAGE9; GAGEB1; PAGE-1; GAGE-9
UniProt Entry Name
PAGE1_HUMAN
NCBI Description
This gene belongs to a family of genes that are expressed in a variety of tumors but not in normal tissues, except for the testis. Unlike the other gene family members, this gene does not encode an antigenic peptide. Nothing is presently known about the function of this protein. [provided by RefSeq, Jul 2008]
Research Articles on PAGE1
Similar Products
Product Notes
The PAGE1 page1 (Catalog #AAA3208047) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PAGE1 antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PAGE1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PAGE1 page1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TKRVCLRNEE QMKLPAEGPE PEADSQEQVH PKTGCERGDG PDVQELGLPN. It is sometimes possible for the material contained within the vial of "PAGE1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
