Testing Data
(Detection limit for recombinant GST tagged SNAP29 is approximately 0.3ng/ml as a capture antibody.)
Mouse SNAP29 Monoclonal Antibody | anti-SNAP29 antibody
SNAP29 (Synaptosomal-Associated Protein, 29kD, CEDNIK, FLJ21051, SNAP-29) (HRP)
Gene Names
SNAP29; CEDNIK; SNAP-29
Applications
Western Blot
Purity
Purified
Synonyms
SNAP29; Monoclonal Antibody; SNAP29 (Synaptosomal-Associated Protein; 29kD; CEDNIK; FLJ21051; SNAP-29) (HRP); Synaptosomal-Associated Protein; SNAP-29; anti-SNAP29 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1C10
Specificity
Recognizes SNAP29.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
258
Applicable Applications for anti-SNAP29 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
SNAP29 (AAH09715, 1aa-258aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDGPDAPADRQQYLRQEVLRRAEATAASTSRSLALMYESEKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTSQPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYPKNPHLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTERKVRQL
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged SNAP29 is approximately 0.3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged SNAP29 is approximately 0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-SNAP29 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
Synaptosomal-associated protein, 29kDa
NCBI Official Synonym Full Names
synaptosome associated protein 29
NCBI Official Symbol
SNAP29
NCBI Official Synonym Symbols
CEDNIK; SNAP-29
NCBI Protein Information
synaptosomal-associated protein 29
Protein Family
NCBI Description
This gene, a member of the SNAP25 gene family, encodes a protein involved in multiple membrane trafficking steps. Two other members of this gene family, SNAP23 and SNAP25, encode proteins that bind a syntaxin protein and mediate synaptic vesicle membrane docking and fusion to the plasma membrane. The protein encoded by this gene binds tightly to multiple syntaxins and is localized to intracellular membrane structures rather than to the plasma membrane. While the protein is mostly membrane-bound, a significant fraction of it is found free in the cytoplasm. Use of multiple polyadenylation sites has been noted for this gene. [provided by RefSeq, Jul 2008]
Research Articles on SNAP29
Similar Products
Product Notes
The SNAP29 (Catalog #AAA6182153) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SNAP29 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SNAP29 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SNAP29, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
