Western Blot (WB)
(Figure 1. Western blot analysis of Mtnd4 using anti-Mtnd4 antibody.)
Rabbit anti-Rat ND4/Mtnd4 Polyclonal Antibody | anti-Mtnd4 antibody
Anti-ND4/Mtnd4 Antibody
Gene Names
mt-Nd4; ND4
Reactivity
Rat
Applications
Western Blot
Purity
Immunogen affinity purified.
Synonyms
ND4/Mtnd4; Polyclonal Antibody; Anti-ND4/Mtnd4 Antibody; NADH-ubiquinone oxidoreductase chain 4; NADH dehydrogenase subunit 4; Mtnd4; mt-Nd4; Nd4; anti-Mtnd4 antibody
Host
Rabbit
Reactivity
Rat
Clonality
Polyclonal
Isotype
IgG
Specificity
No cross reactivity with other proteins.
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
459
Applicable Applications for anti-Mtnd4 antibody
Western blot (WB)
Application Notes
WB: 0.25-0.5ug/ml (Rat)
Tested Species: In-house tested species with positive results.
Tested Species: In-house tested species with positive results.
Immunogen
A synthetic peptide corresponding to a sequence of rat ND4/Mtnd4(ANKKIWTNVTSYSFLVSLLSLSLLWQNDEN).
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen store at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Western Blot (WB)
(Figure 1. Western blot analysis of Mtnd4 using anti-Mtnd4 antibody.)
Western Blot (WB)
(Figure 1. Western blot analysis of Mtnd4 using anti-Mtnd4 antibody.)
Related Product Information for anti-Mtnd4 antibody
Description: Rabbit IgG polyclonal antibody for ND4/Mtnd4 detection. Tested with WB in Rat.
Background: NADH-ubiquinone oxidoreductase chain 4 is a protein that in humans is encoded by the mitochondrial gene MT-ND4. The ND4 protein is a subunit of NADH dehydrogenase (ubiquinone), which is located in the mitochondrial inner membrane and is the largest of the five complexes of the electron transport chain. Variations in the MT-ND4 gene are associated with age-related macular degeneration (AMD), Leber's hereditary optic neuropathy (LHON), mesial temporal lobe epilepsy (MTLE) and cystic fibrosis.
Background: NADH-ubiquinone oxidoreductase chain 4 is a protein that in humans is encoded by the mitochondrial gene MT-ND4. The ND4 protein is a subunit of NADH dehydrogenase (ubiquinone), which is located in the mitochondrial inner membrane and is the largest of the five complexes of the electron transport chain. Variations in the MT-ND4 gene are associated with age-related macular degeneration (AMD), Leber's hereditary optic neuropathy (LHON), mesial temporal lobe epilepsy (MTLE) and cystic fibrosis.
References
1. Arizmendi, J. M., Skehel, J. M., Runswick, M. J., Fearnley, I. M., Walker, J. E. Complementary DNA sequences of two 14.5 kDa subunits of NADH:ubiquinone oxidoreductase from bovine heart mitochondria. Complementation of the primary structure of the complex. FEBS Lett. 313: 80-84, 1992.
2. Attardi, G., Chomyn, A., Doolittle, R. F., Mariottini, P., Ragan, C. I. Seven unidentified reading frames of human mitochondrial DNA encode subunits of the respiratory chain NADH dehydrogenase. Cold Spring Harbor Symp. Quant. Biol. 1: 103-114, 1986.
3. Attardi, G., Chomyn, A., Montoya, J., Ojala, D. Identification and mapping of human mitochondrial genes. Cytogenet. Cell Genet. 32: 85-98, 1982.
2. Attardi, G., Chomyn, A., Doolittle, R. F., Mariottini, P., Ragan, C. I. Seven unidentified reading frames of human mitochondrial DNA encode subunits of the respiratory chain NADH dehydrogenase. Cold Spring Harbor Symp. Quant. Biol. 1: 103-114, 1986.
3. Attardi, G., Chomyn, A., Montoya, J., Ojala, D. Identification and mapping of human mitochondrial genes. Cytogenet. Cell Genet. 32: 85-98, 1982.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
NADH dehydrogenase subunit 4 (mitochondrion)
NCBI Official Synonym Full Names
NADH dehydrogenase 4, mitochondrial
NCBI Official Symbol
mt-Nd4
NCBI Official Synonym Symbols
ND4
NCBI Protein Information
NADH dehydrogenase subunit 4
UniProt Protein Name
NADH-ubiquinone oxidoreductase chain 4
UniProt Gene Name
Mtnd4
UniProt Synonym Gene Names
mt-Nd4; Nd4
Uniprot Description
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone ().
Research Articles on Mtnd4
Similar Products
Product Notes
The Mtnd4 mtnd4 (Catalog #AAA1753103) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-ND4/Mtnd4 Antibody reacts with Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ND4/Mtnd4 can be used in a range of immunoassay formats including, but not limited to, Western blot (WB). WB: 0.25-0.5ug/ml (Rat) Tested Species: In-house tested species with positive results. Researchers should empirically determine the suitability of the Mtnd4 mtnd4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ND4/Mtnd4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
