Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-GPR68 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)

Rabbit GPR68 Polyclonal Antibody | anti-GPR68 antibody

GPR68 Antibody - middle region

Gene Names
GPR68; OGR1; AI2A6; GPR12A
Reactivity
Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GPR68; Polyclonal Antibody; GPR68 Antibody - middle region; anti-GPR68 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SIYFLMHEEVIEDENQHRVCFEHYPIQAWQRAINYYRFLVGFLFPICLLL
Sequence Length
365
Applicable Applications for anti-GPR68 antibody
Western Blot (WB)
Homology
Dog: 79%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 79%; Rabbit: 79%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human GPR68
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-GPR68 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)

Western Blot (WB) (WB Suggested Anti-GPR68 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)
Related Product Information for anti-GPR68 antibody
This is a rabbit polyclonal antibody against GPR68. It was validated on Western Blot

Target Description: Proton-sensing receptor is involved in pH homeostasis. GPR68 may represents an osteoblastic pH sensor regulating cell-mediated responses to acidosis in bone. GPR68 mediates its action by association with G proteins that stimulates inositol phosphate (IP) production or Ca2+ mobilization. The receptor is almost silent at pH 7.8 but fully activated at pH 6.8. Function also as a metastasis suppressor gene in prostate cancer.
Product Categories/Family for anti-GPR68 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
ovarian cancer G-protein coupled receptor 1
NCBI Official Synonym Full Names
G protein-coupled receptor 68
NCBI Official Symbol
GPR68
NCBI Official Synonym Symbols
OGR1; AI2A6; GPR12A
NCBI Protein Information
ovarian cancer G-protein coupled receptor 1
UniProt Protein Name
Ovarian cancer G-protein coupled receptor 1
UniProt Gene Name
GPR68
UniProt Synonym Gene Names
OGR1; OGR-1
UniProt Entry Name
OGR1_HUMAN

NCBI Description

The protein encoded by this gene is a G protein-coupled receptor for sphingosylphosphorylcholine. The encoded protein is a proton-sensing receptor, inactive at pH 7.8 but active at pH 6.8. Mutations in this gene are a cause of amelogenesis imperfecta. [provided by RefSeq, Feb 2017]

Uniprot Description

GPR68: Proton-sensing receptor involved in pH homeostasis. May represents an osteoblastic pH sensor regulating cell-mediated responses to acidosis in bone. Mediates its action by association with G proteins that stimulates inositol phosphate (IP) production or Ca(2+) mobilization. The receptor is almost silent at pH 7.8 but fully activated at pH 6.8. Function also as a metastasis suppressor gene in prostate cancer. Belongs to the G-protein coupled receptor 1 family.

Protein type: Tumor suppressor; Membrane protein, integral; Receptor, GPCR; Membrane protein, multi-pass; GPCR, family 1

Chromosomal Location of Human Ortholog: 14q31

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: G-protein coupled receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway; inflammatory response; negative regulation of monocyte differentiation

Research Articles on GPR68

Similar Products

Product Notes

The GPR68 gpr68 (Catalog #AAA3216415) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GPR68 Antibody - middle region reacts with Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GPR68 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GPR68 gpr68 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SIYFLMHEEV IEDENQHRVC FEHYPIQAWQ RAINYYRFLV GFLFPICLLL. It is sometimes possible for the material contained within the vial of "GPR68, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.