Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: EEF1DSample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human EEF1D Polyclonal Antibody | anti-EEF1D antibody

EEF1D Antibody - middle region

Gene Names
EEF1D; EF1D; EF-1D; FP1047
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
EEF1D; Polyclonal Antibody; EEF1D Antibody - middle region; anti-EEF1D antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TAPQTQHVSPMRQVEPPAKKPATPAEDDEDDDIDLFGSDNEEEDKEAAQL
Sequence Length
281
Applicable Applications for anti-EEF1D antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human EEF1D
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: EEF1DSample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: EEF1DSample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-EEF1D antibody
This gene encodes a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit, delta, functions as guanine nucleotide exchange factor. It is reported that following HIV-1 infection, this subunit interacts with HIV-1 Tat. This interaction results in repression of translation of host cell proteins and enhanced translation of viral proteins. Several alternatively spliced transcript variants encoding multiple isoforms have been found for this gene. Related pseudogenes have been defined on chromosomes 1, 6, 7, 9, 11, 13, 17, 19.
Product Categories/Family for anti-EEF1D antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30 kDa
NCBI Official Full Name
elongation factor 1-delta isoform 1
NCBI Official Synonym Full Names
eukaryotic translation elongation factor 1 delta
NCBI Official Symbol
EEF1D
NCBI Official Synonym Symbols
EF1D; EF-1D; FP1047
NCBI Protein Information
elongation factor 1-delta
UniProt Protein Name
Elongation factor 1-delta
Protein Family
UniProt Gene Name
EEF1D
UniProt Synonym Gene Names
EF1D; EF-1-delta
UniProt Entry Name
EF1D_HUMAN

NCBI Description

This gene encodes a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit, delta, functions as guanine nucleotide exchange factor. It is reported that following HIV-1 infection, this subunit interacts with HIV-1 Tat. This interaction results in repression of translation of host cell proteins and enhanced translation of viral proteins. Several alternatively spliced transcript variants encoding multiple isoforms have been found for this gene. Related pseudogenes have been defined on chromosomes 1, 6, 7, 9, 11, 13, 17, 19.[provided by RefSeq, Aug 2010]

Uniprot Description

EEF1D: EF-1-beta and EF-1-delta stimulate the exchange of GDP bound to EF-1-alpha to GTP. Belongs to the EF-1-beta/EF-1-delta family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Translation elongation; Translation

Chromosomal Location of Human Ortholog: 8q24.3

Cellular Component: eukaryotic translation elongation factor 1 complex; endoplasmic reticulum; cytoplasm; nucleolus; nucleus; cytosol

Molecular Function: signal transducer activity; protein binding; transcription activator binding; DNA binding; translation factor activity, nucleic acid binding; heat shock protein binding; translation elongation factor activity

Biological Process: cellular protein metabolic process; translational elongation; positive regulation of I-kappaB kinase/NF-kappaB cascade; regulation of transcription, DNA-dependent; translation; transcription, DNA-dependent; mRNA transcription; gene expression; signal transduction

Research Articles on EEF1D

Similar Products

Product Notes

The EEF1D eef1d (Catalog #AAA3221988) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EEF1D Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EEF1D can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the EEF1D eef1d for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TAPQTQHVSP MRQVEPPAKK PATPAEDDED DDIDLFGSDN EEEDKEAAQL. It is sometimes possible for the material contained within the vial of "EEF1D, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.