Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ASXL2 Antibody Titration: 0.2-1 ug/mlPositive Control: NCI-H226 cell lysateASXL2 is supported by BioGPS gene expression data to be expressed in NCIH226)

Rabbit ASXL2 Polyclonal Antibody | anti-ASXL2 antibody

ASXL2 antibody - middle region

Gene Names
ASXL2; ASXH2; SHAPNS
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ASXL2; Polyclonal Antibody; ASXL2 antibody - middle region; anti-ASXL2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EEAPVSWEKRPRVTENRQHQQPFQVSPQPFLNRGDRIQVRKVPPLKIPVS
Sequence Length
1435
Applicable Applications for anti-ASXL2 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ASXL2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ASXL2 Antibody Titration: 0.2-1 ug/mlPositive Control: NCI-H226 cell lysateASXL2 is supported by BioGPS gene expression data to be expressed in NCIH226)

Western Blot (WB) (WB Suggested Anti-ASXL2 Antibody Titration: 0.2-1 ug/mlPositive Control: NCI-H226 cell lysateASXL2 is supported by BioGPS gene expression data to be expressed in NCIH226)
Related Product Information for anti-ASXL2 antibody
This is a rabbit polyclonal antibody against ASXL2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ASXL2 is a human homolog of the Drosophila asx gene. Drosophila asx is an enhancer of trithorax (see MIM 159555) and polycomb (see MIM 610231) (ETP) gene that encodes a chromatin protein with dual functions in transcriptional activation and silencing (Katoh and Katoh, 2003 [PubMed 12888926]).

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
154kDa
NCBI Official Full Name
putative Polycomb group protein ASXL2
NCBI Official Synonym Full Names
ASXL transcriptional regulator 2
NCBI Official Symbol
ASXL2
NCBI Official Synonym Symbols
ASXH2; SHAPNS
NCBI Protein Information
putative Polycomb group protein ASXL2
UniProt Protein Name
Putative Polycomb group protein ASXL2
UniProt Gene Name
ASXL2
UniProt Synonym Gene Names
ASXH2; KIAA1685

NCBI Description

This gene encodes a member of a family of epigenetic regulators that bind various histone-modifying enzymes and are involved in the assembly of transcription factors at specific genomic loci. Naturally occurring mutations in this gene are associated with cancer in several tissue types (breast, bladder, pancreas, ovary, prostate, and blood). This gene plays an important role in neurodevelopment, cardiac function, adipogenesis, and osteoclastogenesis. [provided by RefSeq, Feb 2017]

Uniprot Description

ASXL2: Putative Polycomb group (PcG) protein. PcG proteins act by forming multiprotein complexes, which are required to maintain the transcriptionally repressive state of homeotic genes throughout development. PcG proteins are not required to initiate repression, but to maintain it during later stages of development. They probably act via methylation of histones, rendering chromatin heritably changed in its expressibility. Involved in transcriptional regulation mediated by ligand-bound nuclear hormone receptors, such as peroxisome proliferator-activated receptor gamma (PPARG). Acts as coactivator for PPARG and enhances its adipocyte differentiation-inducing activity; the function seems to involve differential recruitment of acetylated and methylated histone H3. A chromosomal aberration involving ASXL2 is a cause of therapy-related myelodysplastic syndrome. Translocation t(2;8)(p23;p11.2) with KAT6A generates a KAT6A-ASXL2 fusion protein. Belongs to the Asx family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 2p23.3

Cellular Component: nucleoplasm

Molecular Function: DNA binding; metal ion binding; peroxisome proliferator activated receptor binding

Biological Process: positive regulation of fat cell differentiation; positive regulation of transcription from RNA polymerase II promoter; protein deubiquitination; transcription, DNA-dependent

Disease: Shashi-pena Syndrome

Research Articles on ASXL2

Similar Products

Product Notes

The ASXL2 asxl2 (Catalog #AAA3213221) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ASXL2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ASXL2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ASXL2 asxl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EEAPVSWEKR PRVTENRQHQ QPFQVSPQPF LNRGDRIQVR KVPPLKIPVS. It is sometimes possible for the material contained within the vial of "ASXL2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.