Western Blot (WB)
(WB Suggested Anti-CCNL2 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateCCNL2 is supported by BioGPS gene expression data to be expressed in Jurkat)
Rabbit CCNL2 Polyclonal Antibody | anti-CCNL2 antibody
CCNL2 antibody - N-terminal region
Gene Names
CCNL2; CCNM; CCNS; PCEE; SB138; ANIA-6B; HLA-ISO; HCLA-ISO
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CCNL2; Polyclonal Antibody; CCNL2 antibody - N-terminal region; anti-CCNL2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TGQVLFQRFFYTKSFVKHSMEHVSMACVHLASKIEEAPRRIRDVINVFHR
Sequence Length
226
Applicable Applications for anti-CCNL2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CCNL2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-CCNL2 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateCCNL2 is supported by BioGPS gene expression data to be expressed in Jurkat)
Western Blot (WB)
(WB Suggested Anti-CCNL2 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateCCNL2 is supported by BioGPS gene expression data to be expressed in Jurkat)
Related Product Information for anti-CCNL2 antibody
This is a rabbit polyclonal antibody against CCNL2. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: CCNL2 belongs to the cyclin family, Cyclin L subfamily. CCNL2 is a transcriptional regulator which participates in regulating the pre-mRNA splicing process. CCNL2 also modulates the expression of critical apoptotic factor, leading to cell apoptosis.
Target Description: CCNL2 belongs to the cyclin family, Cyclin L subfamily. CCNL2 is a transcriptional regulator which participates in regulating the pre-mRNA splicing process. CCNL2 also modulates the expression of critical apoptotic factor, leading to cell apoptosis.
Product Categories/Family for anti-CCNL2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
cyclin-L2 isoform B
NCBI Official Synonym Full Names
cyclin L2
NCBI Official Symbol
CCNL2
NCBI Official Synonym Symbols
CCNM; CCNS; PCEE; SB138; ANIA-6B; HLA-ISO; HCLA-ISO
NCBI Protein Information
cyclin-L2
UniProt Protein Name
Cyclin-L2
Protein Family
UniProt Gene Name
CCNL2
UniProt Entry Name
CCNL2_HUMAN
NCBI Description
The protein encoded by this gene belongs to the cyclin family. Through its interaction with several proteins, such as RNA polymerase II, splicing factors, and cyclin-dependent kinases, this protein functions as a regulator of the pre-mRNA splicing process, as well as in inducing apoptosis by modulating the expression of apoptotic and antiapoptotic proteins. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Aug 2011]
Research Articles on CCNL2
1. Therefore, cyclin L2-mediated control of SAMHD1 levels in macrophages supports HIV-1 replication.
Similar Products
Product Notes
The CCNL2 ccnl2 (Catalog #AAA3210050) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CCNL2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CCNL2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CCNL2 ccnl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TGQVLFQRFF YTKSFVKHSM EHVSMACVHL ASKIEEAPRR IRDVINVFHR. It is sometimes possible for the material contained within the vial of "CCNL2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
