Western Blot (WB)
(WB Suggested Anti-N6AMT1 Antibody Titration: 0.2-1 ug/mlPositive Control: NCI-H226 cell lysateN6AMT1 is supported by BioGPS gene expression data to be expressed in NCIH226)
Rabbit N6AMT1 Polyclonal Antibody | anti-N6AMT1 antibody
N6AMT1 antibody - N-terminal region
Gene Names
N6AMT1; MTQ2; HEMK2; N6AMT; PRED28; C21orf127; m.HsaHemK2P
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
N6AMT1; Polyclonal Antibody; N6AMT1 antibody - N-terminal region; anti-N6AMT1 antibody
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLNALEAAAAELAGVEICL
Sequence Length
186
Applicable Applications for anti-N6AMT1 antibody
Western Blot (WB)
Homology
Cow: 93%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human N6AMT1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-N6AMT1 Antibody Titration: 0.2-1 ug/mlPositive Control: NCI-H226 cell lysateN6AMT1 is supported by BioGPS gene expression data to be expressed in NCIH226)
Western Blot (WB)
(WB Suggested Anti-N6AMT1 Antibody Titration: 0.2-1 ug/mlPositive Control: NCI-H226 cell lysateN6AMT1 is supported by BioGPS gene expression data to be expressed in NCIH226)
Western Blot (WB)
(WB Suggested Anti-N6AMT1 Antibody Titration: 5% MilkELISA Titer: dilution: 1:500Positive Control: Mouse Brain lysate)
Western Blot (WB)
(WB Suggested Anti-N6AMT1 Antibody Titration: 5% MilkELISA Titer: dilution: 1:500Positive Control: Mouse Brain lysate)
Related Product Information for anti-N6AMT1 antibody
This is a rabbit polyclonal antibody against N6AMT1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The protein encoded by this gene belongs to the methyltransferase superfamily. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.
Target Description: The protein encoded by this gene belongs to the methyltransferase superfamily. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.
Product Categories/Family for anti-N6AMT1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
20kDa
NCBI Official Full Name
methyltransferase N6AMT1 isoform 2
NCBI Official Synonym Full Names
N-6 adenine-specific DNA methyltransferase 1
NCBI Official Symbol
N6AMT1
NCBI Official Synonym Symbols
MTQ2; HEMK2; N6AMT; PRED28; C21orf127; m.HsaHemK2P
NCBI Protein Information
methyltransferase N6AMT1
Protein Family
NCBI Description
This gene encodes an N(6)-adenine-specific DNA methyltransferase. The encoded enzyme may be involved in the methylation of release factor I during translation termination. This enzyme is also involved in converting the arsenic metabolite monomethylarsonous acid to the less toxic dimethylarsonic acid. Alternative splicing pf this gene results in multiple transcript variants. A related pseudogene has been identified on chromosome 11. [provided by RefSeq, Jul 2014]
Research Articles on N6AMT1
Similar Products
Product Notes
The N6AMT1 (Catalog #AAA3207938) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The N6AMT1 antibody - N-terminal region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's N6AMT1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the N6AMT1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MAGENFATPF HGHVGRGAFS DVYEPAEDTF LLLNALEAAA AELAGVEICL. It is sometimes possible for the material contained within the vial of "N6AMT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
