Western Blot (WB)
(Host: RabbitTarget Name: BTN2A2Sample Tissue: Stomach Tumor lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Human BTN2A2 Polyclonal Antibody | anti-BTN2A2 antibody
BTN2A2 Antibody - middle region
Gene Names
BTN2A2; BTF2; BT2.2; BTN2.2
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
BTN2A2; Polyclonal Antibody; BTN2A2 Antibody - middle region; anti-BTN2A2 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 23% sucrose.
Sequence
Synthetic peptide located within the following region: LRWRRTFLHAADVVLDPDTAHPELFLSEDRRSVRRGPYRQRVPDNPERFD
Sequence Length
523
Applicable Applications for anti-BTN2A2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human BTN2A2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: BTN2A2Sample Tissue: Stomach Tumor lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: BTN2A2Sample Tissue: Stomach Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-BTN2A2 antibody
Butyrophilin is the major protein associated with fat droplets in the milk. This gene is a member of the BTN2 subfamily of genes, which encode proteins belonging to the butyrophilin protein family. The gene is located in a cluster on chromosome 6, consisting of seven genes belonging to the expanding B7/butyrophilin-like group, a subset of the immunoglobulin gene superfamily. The encoded protein is a type I receptor glycoprotein involved in lipid, fatty-acid and sterol metabolism. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-BTN2A2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58 kDa
NCBI Official Full Name
butyrophilin subfamily 2 member A2 isoform a
NCBI Official Synonym Full Names
butyrophilin subfamily 2 member A2
NCBI Official Symbol
BTN2A2
NCBI Official Synonym Symbols
BTF2; BT2.2; BTN2.2
NCBI Protein Information
butyrophilin subfamily 2 member A2
UniProt Protein Name
Butyrophilin subfamily 2 member A2
Protein Family
UniProt Gene Name
BTN2A2
UniProt Synonym Gene Names
BT2.2; BTF2
UniProt Entry Name
BT2A2_HUMAN
NCBI Description
Butyrophilin is the major protein associated with fat droplets in the milk. This gene is a member of the BTN2 subfamily of genes, which encode proteins belonging to the butyrophilin protein family. The gene is located in a cluster on chromosome 6, consisting of seven genes belonging to the expanding B7/butyrophilin-like group, a subset of the immunoglobulin gene superfamily. The encoded protein is a type I receptor glycoprotein involved in lipid, fatty-acid and sterol metabolism. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2010]
Research Articles on BTN2A2
Similar Products
Product Notes
The BTN2A2 btn2a2 (Catalog #AAA3220532) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BTN2A2 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BTN2A2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BTN2A2 btn2a2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LRWRRTFLHA ADVVLDPDTA HPELFLSEDR RSVRRGPYRQ RVPDNPERFD. It is sometimes possible for the material contained within the vial of "BTN2A2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
