Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CCNA2 Antibody Titration: 1ug/mlPositive Control: HepG2 cell lysateCCNA2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

Rabbit CCNA2 Polyclonal Antibody | anti-CCNA2 antibody

CCNA2 antibody - C-terminal region

Gene Names
CCNA2; CCN1; CCNA
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
CCNA2; Polyclonal Antibody; CCNA2 antibody - C-terminal region; anti-CCNA2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL
Sequence Length
432
Applicable Applications for anti-CCNA2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 91%; Horse: 91%; Human: 100%; Mouse: 91%; Pig: 100%; Rabbit: 100%; Rat: 91%; Zebrafish: 81%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CCNA2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CCNA2 Antibody Titration: 1ug/mlPositive Control: HepG2 cell lysateCCNA2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

Western Blot (WB) (WB Suggested Anti-CCNA2 Antibody Titration: 1ug/mlPositive Control: HepG2 cell lysateCCNA2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)
Related Product Information for anti-CCNA2 antibody
This is a rabbit polyclonal antibody against CCNA2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Cyclin A is essential for the control of the cell cycle at the G1/S (start) and the G2/M (mitosis) transitions.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
890
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49kDa
NCBI Official Full Name
cyclin-A2
NCBI Official Synonym Full Names
cyclin A2
NCBI Official Symbol
CCNA2
NCBI Official Synonym Symbols
CCN1; CCNA
NCBI Protein Information
cyclin-A2
UniProt Protein Name
Cyclin-A2
Protein Family
UniProt Gene Name
CCNA2
UniProt Synonym Gene Names
CCN1; CCNA; Cyclin-A
UniProt Entry Name
CCNA2_HUMAN

NCBI Description

The protein encoded by this gene belongs to the highly conserved cyclin family, whose members function as regulators of the cell cycle. This protein binds and activates cyclin-dependent kinase 2 and thus promotes transition through G1/S and G2/M. [provided by RefSeq, Aug 2016]

Uniprot Description

CCNA2: a member of the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Expressed in all tissues tested. This cyclin binds and activates CDC2 or CDK2 kinases, and thus promotes both cell cycle G1/S and G2/M transitions.

Protein type: Cell cycle regulation; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 4q27

Cellular Component: nucleoplasm; male pronucleus; cytoplasm; female pronucleus; nucleus

Molecular Function: protein binding; protein kinase binding

Biological Process: mitosis; positive regulation of fibroblast proliferation; organ regeneration; response to glucagon stimulus; cell division; positive regulation of transcription, DNA-dependent; mitotic cell cycle G2/M transition DNA damage checkpoint; regulation of G2/M transition of mitotic cell cycle; Ras protein signal transduction; regulation of cyclin-dependent protein kinase activity; mitotic cell cycle; G2/M transition of mitotic cell cycle; response to estradiol stimulus

Research Articles on CCNA2

Similar Products

Product Notes

The CCNA2 ccna2 (Catalog #AAA3224392) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CCNA2 antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CCNA2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CCNA2 ccna2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YTLESLKPCL MDLHQTYLKA PQHAQQSIRE KYKNSKYHGV SLLNPPETLN L. It is sometimes possible for the material contained within the vial of "CCNA2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.