Western Blot (WB)
(WB Suggested Anti-PCNP Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysate)
Rabbit PCNP Polyclonal Antibody | anti-PCNP antibody
PCNP antibody - middle region
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PCNP; Polyclonal Antibody; PCNP antibody - middle region; anti-PCNP antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AKMRMKNIGRDTPTSAGPNSFNKGKHGFSDNQKLWERNIKSHLGNVHDQD
Sequence Length
178
Applicable Applications for anti-PCNP antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PCNP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-PCNP Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysate)
Western Blot (WB)
(WB Suggested Anti-PCNP Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysate)
Related Product Information for anti-PCNP antibody
This is a rabbit polyclonal antibody against PCNP. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: PCNP may be involved in cell cycle regulation.
Target Description: PCNP may be involved in cell cycle regulation.
Product Categories/Family for anti-PCNP antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19kDa
NCBI Official Full Name
PEST proteolytic signal-containing nuclear protein isoform a
NCBI Official Synonym Full Names
PEST proteolytic signal containing nuclear protein
NCBI Official Symbol
PCNP
UniProt Protein Name
PEST proteolytic signal-containing nuclear protein
Protein Family
UniProt Gene Name
PCNP
UniProt Synonym Gene Names
PCNP; PEST-containing nuclear protein
Uniprot Description
May be involved in cell cycle regulation.
Similar Products
Product Notes
The PCNP pcnp (Catalog #AAA3213339) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PCNP antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PCNP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PCNP pcnp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AKMRMKNIGR DTPTSAGPNS FNKGKHGFSD NQKLWERNIK SHLGNVHDQD. It is sometimes possible for the material contained within the vial of "PCNP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
