Western Blot (WB)
(WB Suggested Anti-Accn2 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Heart)
Rabbit Accn2 Polyclonal Antibody | anti-ASIC1 antibody
Accn2 antibody - N-terminal region
Gene Names
Asic1; ASIC; Accn2; BNaC2; ASIC1a; AI843610; B530003N02Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Accn2; Polyclonal Antibody; Accn2 antibody - N-terminal region; anti-ASIC1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MELKTEEEEVGGVQPVSIQAFASSSTLHGLAHIFSYERLSLKRALWALCF
Sequence Length
526
Applicable Applications for anti-ASIC1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-Accn2 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Heart)
Western Blot (WB)
(WB Suggested Anti-Accn2 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Heart)
Related Product Information for anti-ASIC1 antibody
This is a rabbit polyclonal antibody against Accn2. It was validated on Western Blot
Target Description: Accn2 is a cation channel with high affinity for sodium, which is gated by extracellular protons and inhibited by the diuretic amiloride. It also permeable for Ca2+, Li+ and K+. It generates a biphasic current with a fast inactivating and a slow sustained phase and mediates glutamate-independent Ca2+ entry into neurons upon acidosis. This Ca2+ overloading is toxic for cortical neurons and may be in part responsible for ischemic brain injury. Heteromeric channel assembly seems to modulate channel properties. Accn2 functions as a postsynaptic proton receptor that influences intracellular Ca2+ concentration and calmodulin-dependent protein kinase II phosphorylation and thereby the density of dendritic spines. It modulates activity in the circuits underlying innate fear.
Target Description: Accn2 is a cation channel with high affinity for sodium, which is gated by extracellular protons and inhibited by the diuretic amiloride. It also permeable for Ca2+, Li+ and K+. It generates a biphasic current with a fast inactivating and a slow sustained phase and mediates glutamate-independent Ca2+ entry into neurons upon acidosis. This Ca2+ overloading is toxic for cortical neurons and may be in part responsible for ischemic brain injury. Heteromeric channel assembly seems to modulate channel properties. Accn2 functions as a postsynaptic proton receptor that influences intracellular Ca2+ concentration and calmodulin-dependent protein kinase II phosphorylation and thereby the density of dendritic spines. It modulates activity in the circuits underlying innate fear.
Product Categories/Family for anti-ASIC1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60kDa
NCBI Official Full Name
acid-sensing ion channel 1 isoform 1
NCBI Official Synonym Full Names
acid-sensing (proton-gated) ion channel 1
NCBI Official Symbol
Asic1
NCBI Official Synonym Symbols
ASIC; Accn2; BNaC2; ASIC1a; AI843610; B530003N02Rik
NCBI Protein Information
acid-sensing ion channel 1
UniProt Protein Name
Acid-sensing ion channel 1
Protein Family
UniProt Gene Name
Asic1
UniProt Synonym Gene Names
Accn2; Asic; Bnac2; ASIC1; BNaC2
UniProt Entry Name
ASIC1_MOUSE
Uniprot Description
ASIC1: non-voltage-gated amiloride-sensitive cation channel permeable for sodium, potassium and lithium. A member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. Expressed in most if not all brain neurons.
Protein type: Transporter; Membrane protein, multi-pass; Transporter, ion channel; Membrane protein, integral; Channel, cation
Cellular Component: cell surface; membrane; integral to plasma membrane; dendritic spine; integral to membrane; plasma membrane; synapse; dendritic shaft
Molecular Function: amiloride-sensitive sodium channel activity; monovalent inorganic cation transmembrane transporter activity; protein binding; ion gated channel activity; ion channel activity; cation channel activity; sodium channel activity
Biological Process: regulation of membrane potential; transport; calcium ion transport; sodium ion transport; monovalent inorganic cation transport; ion transport; sensory perception of sour taste; response to acidity; cation transport; associative learning; memory; negative regulation of neurotransmitter secretion
Research Articles on ASIC1
Similar Products
Product Notes
The ASIC1 asic1 (Catalog #AAA3202407) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Accn2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Accn2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ASIC1 asic1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MELKTEEEEV GGVQPVSIQA FASSSTLHGL AHIFSYERLS LKRALWALCF. It is sometimes possible for the material contained within the vial of "Accn2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
