Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-GPX2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysateGPX2 is supported by BioGPS gene expression data to be expressed in HepG2)

Rabbit GPX2 Polyclonal Antibody | anti-GPX2 antibody

GPX2 antibody - middle region

Gene Names
GPX2; GPRP; GPx-2; GI-GPx; GPRP-2; GPx-GI; GSHPx-2; GSHPX-GI
Reactivity
Cow, Dog, Human, Mouse, Pig, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GPX2; Polyclonal Antibody; GPX2 antibody - middle region; anti-GPX2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse, Pig, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GGGYQPTFTLVQKCEVNGQNEHPVFAYLKDKLPYPYDDPFSLMTDPKLII
Sequence Length
190
Applicable Applications for anti-GPX2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Zebrafish: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human GPX2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-GPX2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysateGPX2 is supported by BioGPS gene expression data to be expressed in HepG2)

Western Blot (WB) (WB Suggested Anti-GPX2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysateGPX2 is supported by BioGPS gene expression data to be expressed in HepG2)
Related Product Information for anti-GPX2 antibody
This is a rabbit polyclonal antibody against GPX2. It was validated on Western Blot

Target Description: This gene is a member of the glutathione peroxidase family and encodes a selenium-dependent glutathione peroxidase that is one of two isoenzymes responsible for the majority of the glutathione-dependent hydrogen peroxide-reducing activity in the epithelium of the gastrointestinal tract. Studies in knockout mice indicate that mRNA expression levels respond to luminal microflora, suggesting a role of the ileal glutathione peroxidases in preventing inflammation in the GI tract.
Product Categories/Family for anti-GPX2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22kDa
NCBI Official Full Name
glutathione peroxidase 2
NCBI Official Synonym Full Names
glutathione peroxidase 2
NCBI Official Symbol
GPX2
NCBI Official Synonym Symbols
GPRP; GPx-2; GI-GPx; GPRP-2; GPx-GI; GSHPx-2; GSHPX-GI
NCBI Protein Information
glutathione peroxidase 2
UniProt Protein Name
Glutathione peroxidase 2
Protein Family
UniProt Gene Name
GPX2
UniProt Synonym Gene Names
GPx-2; GSHPx-2; GPx-GI; GSHPx-GI; GPRP-2
UniProt Entry Name
GPX2_HUMAN

NCBI Description

The protein encoded by this gene belongs to the glutathione peroxidase family, members of which catalyze the reduction of organic hydroperoxides and hydrogen peroxide (H2O2) by glutathione, and thereby protect cells against oxidative damage. Several isozymes of this gene family exist in vertebrates, which vary in cellular location and substrate specificity. This isozyme is predominantly expressed in the gastrointestinal tract (also in liver in human), is localized in the cytoplasm, and whose preferred substrate is hydrogen peroxide. Overexpression of this gene is associated with increased differentiation and proliferation in colorectal cancer. This isozyme is also a selenoprotein, containing the rare amino acid selenocysteine (Sec) at its active site. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2016]

Uniprot Description

GPX2: Could play a major role in protecting mammals from the toxicity of ingested organic hydroperoxides. Tert-butyl hydroperoxide, cumene hydroperoxide and linoleic acid hydroperoxide but not phosphatidycholine hydroperoxide, can act as acceptors. Belongs to the glutathione peroxidase family.

Protein type: EC 1.11.1.9; Oxidoreductase; Other Amino Acids Metabolism - glutathione; Lipid Metabolism - arachidonic acid

Chromosomal Location of Human Ortholog: 14q24.1

Cellular Component: cytoplasm; cytosol

Molecular Function: electron carrier activity; glutathione peroxidase activity

Biological Process: response to reactive oxygen species; response to symbiotic bacterium; negative regulation of inflammatory response to antigenic stimulus; thermoregulation; interaction with symbiont

Research Articles on GPX2

Similar Products

Product Notes

The GPX2 gpx2 (Catalog #AAA3206159) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GPX2 antibody - middle region reacts with Cow, Dog, Human, Mouse, Pig, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GPX2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GPX2 gpx2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GGGYQPTFTL VQKCEVNGQN EHPVFAYLKD KLPYPYDDPF SLMTDPKLII. It is sometimes possible for the material contained within the vial of "GPX2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.