Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: NOXA1Sample Type: HCT15 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human NOXA1 Polyclonal Antibody | anti-NOXA1 antibody

NOXA1 Antibody - middle region

Gene Names
NOXA1; p51NOX; NY-CO-31; SDCCAG31
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
NOXA1; Polyclonal Antibody; NOXA1 Antibody - middle region; anti-NOXA1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KAKVVASAIPDDQGWGVRPQQPQGPGANHDARSLIMDSPRAGTHQGPLDA
Sequence Length
483
Applicable Applications for anti-NOXA1 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human NOXA1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: NOXA1Sample Type: HCT15 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: NOXA1Sample Type: HCT15 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-NOXA1 antibody
This is a rabbit polyclonal antibody against NOXA1. It was validated on Western Blot

Target Description: This gene encodes a protein which activates NADPH oxidases, enzymes which catalyze a reaction generating reactive oxygen species. The encoded protein contains four N-terminal tetratricopeptide domains and a C-terminal Src homology 3 domain. Interaction between the encoded protein and proteins in the oxidase regulatory complex occur via the tetratricopeptide domains. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-NOXA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Full Name
NADPH oxidase activator 1 isoform 1
NCBI Official Synonym Full Names
NADPH oxidase activator 1
NCBI Official Symbol
NOXA1
NCBI Official Synonym Symbols
p51NOX; NY-CO-31; SDCCAG31
NCBI Protein Information
NADPH oxidase activator 1
UniProt Protein Name
NADPH oxidase activator 1
Protein Family
UniProt Gene Name
NOXA1
UniProt Synonym Gene Names
P51NOX; NOX activator 1
UniProt Entry Name
NOXA1_HUMAN

NCBI Description

This gene encodes a protein which activates NADPH oxidases, enzymes which catalyze a reaction generating reactive oxygen species. The encoded protein contains four N-terminal tetratricopeptide domains and a C-terminal Src homology 3 domain. Interaction between the encoded protein and proteins in the oxidase regulatory complex occur via the tetratricopeptide domains. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011]

Uniprot Description

NOXA1: Functions as an activator of NOX1, a superoxide- producing NADPH oxidase. Functions in the production of reactive oxygen species (ROS) which participate in a variety of biological processes including host defense, hormone biosynthesis, oxygen sensing and signal transduction. May also activate CYBB/gp91phox and NOX3. Belongs to the NCF2/NOXA1 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Activator

Chromosomal Location of Human Ortholog: 9q34.3

Cellular Component: cytoplasm; NADPH oxidase complex

Molecular Function: protein binding; enzyme binding; Rac GTPase binding; superoxide-generating NADPH oxidase activator activity; SH3 domain binding

Biological Process: positive regulation of catalytic activity; superoxide metabolic process; regulation of hydrogen peroxide metabolic process

Research Articles on NOXA1

Similar Products

Product Notes

The NOXA1 noxa1 (Catalog #AAA3210674) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NOXA1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NOXA1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NOXA1 noxa1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KAKVVASAIP DDQGWGVRPQ QPQGPGANHD ARSLIMDSPR AGTHQGPLDA. It is sometimes possible for the material contained within the vial of "NOXA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.