Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CTSL blocking peptide

CTSL Peptide - middle region

Gene Names
Ctsl; fs; MEP; nkt; CatL; Ctsl1; 1190035F06Rik
Reactivity
Mouse
Synonyms
CTSL; CTSL Peptide - middle region; CTSL blocking peptide
Ordering
For Research Use Only!
Reactivity
Mouse
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: AMDASHPSLQFYSSGIYYEPNCSSKNLDHGVLLVGYGYEGTDSNKNKYWL
Sequence Length
334
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for CTSL blocking peptide
This is a synthetic peptide designed for use in combination with anti- CTSL Antibody, made

Target Description: This gene encodes a member of the peptidase C1 (papain) family of cysteine proteases. The encoded preproprotein is proteolytically processed to generate multiple protein products. These products include the activation peptide and the cathepsin L1 heavy and light chains. The mature enzyme appears to be important in embryonic development through its processing of histone H3 and may play a role in disease progression in a model of kidney disease. Homozygous knockout mice for this gene exhibit hair loss, skin thickening, bone and heart defects, and enhanced susceptibility to bacterial infection. A pseudogene of this gene has been identified in the genome.
Product Categories/Family for CTSL blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36 kDa
NCBI Official Full Name
cathepsin L1 preproprotein
NCBI Official Synonym Full Names
cathepsin L
NCBI Official Symbol
Ctsl
NCBI Official Synonym Symbols
fs; MEP; nkt; CatL; Ctsl1; 1190035F06Rik
NCBI Protein Information
cathepsin L1
UniProt Protein Name
Cathepsin L1
UniProt Gene Name
Ctsl
UniProt Synonym Gene Names
Ctsl1; MEP

NCBI Description

This gene encodes a member of the peptidase C1 (papain) family of cysteine proteases. The encoded preproprotein is proteolytically processed to generate multiple protein products. These products include the activation peptide and the cathepsin L1 heavy and light chains. The mature enzyme appears to be important in embryonic development through its processing of histone H3 and may play a role in disease progression in a model of kidney disease. Homozygous knockout mice for this gene exhibit hair loss, skin thickening, bone and heart defects, and enhanced susceptibility to bacterial infection. A pseudogene of this gene has been identified in the genome. [provided by RefSeq, Aug 2015]

Uniprot Description

CTSL2: Cysteine protease. May have an important role in corneal physiology. Belongs to the peptidase C1 family.

Protein type: EC 3.4.22.15; Protease; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 13 B3|13 33.26 cM

Cellular Component: apical part of cell; cytoplasm; cytoplasmic vesicle; external side of plasma membrane; extracellular space; lysosome; microvillus; neuron projection; nucleolus; nucleus; perikaryon; secretory granule; vacuole

Molecular Function: aminopeptidase activity; cysteine-type carboxypeptidase activity; cysteine-type endopeptidase activity; histone binding; kininogen binding; peptide binding; protein binding; protein complex binding

Biological Process: catagen; cell communication; decidualization; hair follicle morphogenesis; protein autoprocessing; protein processing; proteolysis; proteolysis involved in cellular protein catabolic process

Research Articles on CTSL

Similar Products

Product Notes

The CTSL ctsl (Catalog #AAA3248603) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The CTSL Peptide - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: AMDASHPSLQ FYSSGIYYEP NCSSKNLDHG VLLVGYGYEG TDSNKNKYWL. It is sometimes possible for the material contained within the vial of "CTSL, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.