Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CTSLSample Tissue: Mouse Stomach lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Mouse CTSL Polyclonal Antibody | anti-CTSL antibody

CTSL Antibody - middle region

Gene Names
Ctsl; fs; MEP; nkt; CatL; Ctsl1; 1190035F06Rik
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
CTSL; Polyclonal Antibody; CTSL Antibody - middle region; anti-CTSL antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AMDASHPSLQFYSSGIYYEPNCSSKNLDHGVLLVGYGYEGTDSNKNKYWL
Sequence Length
334
Applicable Applications for anti-CTSL antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse CTSL
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CTSLSample Tissue: Mouse Stomach lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CTSLSample Tissue: Mouse Stomach lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CTSL antibody
This gene encodes a member of the peptidase C1 (papain) family of cysteine proteases. The encoded preproprotein is proteolytically processed to generate multiple protein products. These products include the activation peptide and the cathepsin L1 heavy and light chains. The mature enzyme appears to be important in embryonic development through its processing of histone H3 and may play a role in disease progression in a model of kidney disease. Homozygous knockout mice for this gene exhibit hair loss, skin thickening, bone and heart defects, and enhanced susceptibility to bacterial infection. A pseudogene of this gene has been identified in the genome.
Product Categories/Family for anti-CTSL antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36 kDa
NCBI Official Full Name
cathepsin L1 preproprotein
NCBI Official Synonym Full Names
cathepsin L
NCBI Official Symbol
Ctsl
NCBI Official Synonym Symbols
fs; MEP; nkt; CatL; Ctsl1; 1190035F06Rik
NCBI Protein Information
cathepsin L1
UniProt Protein Name
Cathepsin L1
UniProt Gene Name
Ctsl
UniProt Synonym Gene Names
Ctsl1; MEP

NCBI Description

This gene encodes a member of the peptidase C1 (papain) family of cysteine proteases. The encoded preproprotein is proteolytically processed to generate multiple protein products. These products include the activation peptide and the cathepsin L1 heavy and light chains. The mature enzyme appears to be important in embryonic development through its processing of histone H3 and may play a role in disease progression in a model of kidney disease. Homozygous knockout mice for this gene exhibit hair loss, skin thickening, bone and heart defects, and enhanced susceptibility to bacterial infection. A pseudogene of this gene has been identified in the genome. [provided by RefSeq, Aug 2015]

Uniprot Description

CTSL2: Cysteine protease. May have an important role in corneal physiology. Belongs to the peptidase C1 family.

Protein type: EC 3.4.22.15; Protease; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 13 B3|13 33.26 cM

Cellular Component: apical part of cell; cytoplasm; cytoplasmic vesicle; external side of plasma membrane; extracellular space; lysosome; microvillus; neuron projection; nucleolus; nucleus; perikaryon; secretory granule; vacuole

Molecular Function: aminopeptidase activity; cysteine-type carboxypeptidase activity; cysteine-type endopeptidase activity; histone binding; kininogen binding; peptide binding; protein binding; protein complex binding

Biological Process: catagen; cell communication; decidualization; hair follicle morphogenesis; protein autoprocessing; protein processing; proteolysis; proteolysis involved in cellular protein catabolic process

Research Articles on CTSL

Similar Products

Product Notes

The CTSL ctsl (Catalog #AAA3224290) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CTSL Antibody - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's CTSL can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CTSL ctsl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AMDASHPSLQ FYSSGIYYEP NCSSKNLDHG VLLVGYGYEG TDSNKNKYWL. It is sometimes possible for the material contained within the vial of "CTSL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.