Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot rabbit polyclonal antibody. Western Blot analysis of JAM3 expression in human liver.)

Rabbit anti-Human, Mouse Junctional Adhesion Molecule C Polyclonal Antibody | anti-JAMC antibody

Junctional Adhesion Molecule C (JAMC, JAM-C, FLJ14529, Junctional Adhesion Molecule 3, JAM3, JAM-3, UNQ859/PRO1868) (PE)

Gene Names
JAM3; JAMC; JAM-2; JAM-3; JAM-C
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Junctional Adhesion Molecule C; Polyclonal Antibody; Junctional Adhesion Molecule C (JAMC; JAM-C; FLJ14529; Junctional Adhesion Molecule 3; JAM3; JAM-3; UNQ859/PRO1868) (PE); anti-JAMC antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human JAM3. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
3626
Applicable Applications for anti-JAMC antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human JAM3, aa1-310 (AAH12147.1).
Immunogen Sequence
MALRRPPRLRLCARLPDFFLLLLFRGCLIGAVNLKSSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQGDLAGRAEILGKTSLKIWNVTRRDSALYRCEVVARNDRKEIDEIVIELTVQVKPVTPVCRVPKAVPVGKMATLHCQESEGHPRPHYSWYRNDVPLPTDSRANPRFRNSSFHLNSETGTLVFTAVHKDDSGQYYCIASNDAGSARCEEQEMEVYDLNIGGIIGGVLVVLAVLALITLGICCAYRRGYFINNKQDGESYKNPGKPDGVNYIRTDEEGDFRHKSSFVI
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot rabbit polyclonal antibody. Western Blot analysis of JAM3 expression in human liver.)

Western Blot (WB) (Western Blot rabbit polyclonal antibody. Western Blot analysis of JAM3 expression in human liver.)

Western Blot (WB)

(JAM3 rabbit polyclonal antibody. Western Blot analysis of JAM3 expression in mouse kidney.)

Western Blot (WB) (JAM3 rabbit polyclonal antibody. Western Blot analysis of JAM3 expression in mouse kidney.)

Western Blot (WB)

(Western Blot analysis of JAM3 expression in transfected 293T cell line by JAM3 polyclonal antibody. Lane 1: JAM3 transfected lysate (35kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of JAM3 expression in transfected 293T cell line by JAM3 polyclonal antibody. Lane 1: JAM3 transfected lysate (35kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-JAMC antibody
JAM3 may participate in cell-cell adhesion distinct from tight junctions.
Product Categories/Family for anti-JAMC antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens junctional adhesion molecule 3, mRNA
NCBI Official Synonym Full Names
junctional adhesion molecule 3
NCBI Official Symbol
JAM3
NCBI Official Synonym Symbols
JAMC; JAM-2; JAM-3; JAM-C
NCBI Protein Information
junctional adhesion molecule C

NCBI Description

Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. The protein encoded by this immunoglobulin superfamily gene member is localized in the tight junctions between high endothelial cells. Unlike other proteins in this family, the this protein is unable to adhere to leukocyte cell lines and only forms weak homotypic interactions. The encoded protein is a member of the junctional adhesion molecule protein family and acts as a receptor for another member of this family. A mutation in an intron of this gene is associated with hemorrhagic destruction of the brain, subependymal calcification, and congenital cataracts. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Apr 2011]

Research Articles on JAMC

Similar Products

Product Notes

The JAMC (Catalog #AAA6383420) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Junctional Adhesion Molecule C (JAMC, JAM-C, FLJ14529, Junctional Adhesion Molecule 3, JAM3, JAM-3, UNQ859/PRO1868) (PE) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Junctional Adhesion Molecule C can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the JAMC for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Junctional Adhesion Molecule C, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.