Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human CRMP1 Monoclonal Antibody | anti-CRMP1 antibody

CRMP1 (Dihydropyrimidinase-related Protein 1, DRP-1, Collapsin Response Mediator Protein 1, CRMP-1, Unc-33-like Phosphoprotein 3, ULIP-3, DPYSL1, ULIP3) (MaxLight 650)

Gene Names
CRMP1; DRP1; DRP-1; CRMP-1; DPYSL1; ULIP-3
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CRMP1; Monoclonal Antibody; CRMP1 (Dihydropyrimidinase-related Protein 1; DRP-1; Collapsin Response Mediator Protein 1; CRMP-1; Unc-33-like Phosphoprotein 3; ULIP-3; DPYSL1; ULIP3) (MaxLight 650); anti-CRMP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2B6
Specificity
Recognizes human CRMP1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-CRMP1 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa221-310 from human CRMP1 (NP_001014809.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
HVVPEPGSSLLTSFEKWHEAADTKSCCDYSLHVDITSWYDGVREELEVLVQDKGVNSFQVYMAYKDVYQMSDSQLYEAFTFLKGLGAVIL
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-CRMP1 antibody
Collapsin-response mediator proteins (CRMPs) are highly expressed in the developing brain where they play major roles in axonal outgrowth, neurite differentiation, and apoptosis. Their continued expression in areas of high synaptic remodeling such as the cerebellum, hippocampus, and the olfactory system suggests that these proteins may also be involved in adult brain plasticity. CRMP-1 was initially identified as a dihydro- pyrimidinase expressed exclusively in brain; later studies have shown that it is involved with neurotrophin (NT) 3-induced neurite formation and outgrowth. CRMP-1 localization switches from axonal to somatodendritic when neurons reach functional maturity, suggesting that it is involved in early neuronal differentiation as well as in later processes related to the survival or death of the newly generated neurons.
Product Categories/Family for anti-CRMP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
74,262 Da
NCBI Official Full Name
dihydropyrimidinase-related protein 1 isoform 1
NCBI Official Synonym Full Names
collapsin response mediator protein 1
NCBI Official Symbol
CRMP1
NCBI Official Synonym Symbols
DRP1; DRP-1; CRMP-1; DPYSL1; ULIP-3
NCBI Protein Information
dihydropyrimidinase-related protein 1; dihydropyrimidinase-like 1; unc-33-like phosphoprotein 3
UniProt Protein Name
Dihydropyrimidinase-related protein 1
UniProt Gene Name
CRMP1
UniProt Synonym Gene Names
DPYSL1; ULIP3; DRP-1; CRMP-1; ULIP-3
UniProt Entry Name
DPYL1_HUMAN

NCBI Description

This gene encodes a member of a family of cytosolic phosphoproteins expressed exclusively in the nervous system. The encoded protein is thought to be a part of the semaphorin signal transduction pathway implicated in semaphorin-induced growth cone collapse during neural development. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2008]

Uniprot Description

CRMP-1: Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. Plays a role in axon guidance, invasive growth and cell migration. Belongs to the DHOase family. Hydantoinase/dihydropyrimidinase subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell development/differentiation; Cytoskeletal; Hydrolase

Chromosomal Location of Human Ortholog: 4p16.1

Cellular Component: cell soma; cytoplasm; dendrite; microtubule organizing center; spindle; cytosol

Molecular Function: hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amides; protein binding

Biological Process: axon guidance; nervous system development; nucleobase, nucleoside, nucleotide and nucleic acid metabolic process; pyrimidine base catabolic process

Research Articles on CRMP1

Similar Products

Product Notes

The CRMP1 crmp1 (Catalog #AAA6221642) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CRMP1 (Dihydropyrimidinase-related Protein 1, DRP-1, Collapsin Response Mediator Protein 1, CRMP-1, Unc-33-like Phosphoprotein 3, ULIP-3, DPYSL1, ULIP3) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CRMP1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CRMP1 crmp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CRMP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.