SDS-Page
(Recombinant Mouse IL-5RA/IL-5 R alpha/CD125 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)
IL-5RA/IL-5 R alpha/CD125 Recombinant Protein | IL-5RA recombinant protein
Recombinant Mouse IL-5RA/IL-5 R alpha/CD125 Protein
Gene Names
Il5ra; Il5r; CD125; CDw125
Purity
>95% by SDS-PAGE.
Synonyms
IL-5RA/IL-5 R alpha/CD125; Recombinant Mouse IL-5RA/IL-5 R alpha/CD125 Protein; Interleukin-5 receptor subunit alpha; IL-5 receptor subunit alpha; IL-5R subunit alpha; IL-5R-alpha; IL-5RA; CD125; Il5ra; Il5r; IL-5RA recombinant protein
Host
Human Cells
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 um filtered solution of PBS, pH7.4.
Sequence
DLLNHKKFLLLPPVNFTIKATGLAQVLLHWDPNPDQEQRHVDLEYHVKINAPQEDEYDTRKTESKCVTPLHEGFAASVRTILKSSHTTLASSWVSAELKAPPGSPGTSVTNLTCTTHTVVSSHTHLRPYQVSLRCTWLVGKDAPEDTQYFLYYRFGVLTEKCQEYSRDALNRNTACWFPRTFINSKGFEQLAVHINGSSKRAAIKPFDQLFSPLAIDQVNPPRNVTVEIESNSLYIQWEKPLSAFPDHCFNYELK
Sequence Length
415
Species
Mouse
Endotoxin
< 1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.
SDS-Page
(Recombinant Mouse IL-5RA/IL-5 R alpha/CD125 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)
SDS-Page
(Recombinant Mouse IL-5RA/IL-5 R alpha/CD125 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)
Related Product Information for IL-5RA recombinant protein
Description: Recombinant Mouse IL-5RA/IL-5 R alpha/CD125 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Asp18-His339) of mouse IL-5RA/IL-5 R alpha/CD125 (Accession #P21183) fused with a 6xHis tag at the C-terminus.
Background: Interleukin 5 Receptor alpha (IL-5 Ralpha), also known as CD125, is a hematopoietin receptor that plays a dominantrole in eosinophil biology. Mature mouse IL-5 Ralpha consists of a 322 amino acid (aa) extracellular domain (ECD)with a WSxWS motif and a four cysteine motif, a 22 aa transmembrane segment, and a 54 aa cytoplasmicdomain. The high affinity receptor for IL-5 is a complex that consists of the ligand binding IL-5 R alpha and thetransmembrane common beta chain (beta c/CD131) which is shared with the receptor complexes for IL-3 and GM-CSF. IL-5 R alpha binds IL-5 at low affinity and then associates with preformed beta c oligomers to form the signaling-competent receptor complex. IL-5 stimulation of CD34+ hematopoietic progenitor cells induces the up-regulation of transmembrane IL-5 R alpha followed by eosinophilic differentiation and activation. IL-5 R alpha alsopromotes the differentiation of basophils and B cells. Exposure of mature eosinophils to IL-5 attenuates theirIL-5 responsiveness by inducing the down-regulation of surface IL-5 Ralpha and increased production of soluble IL-5 Ralpha.
Background: Interleukin 5 Receptor alpha (IL-5 Ralpha), also known as CD125, is a hematopoietin receptor that plays a dominantrole in eosinophil biology. Mature mouse IL-5 Ralpha consists of a 322 amino acid (aa) extracellular domain (ECD)with a WSxWS motif and a four cysteine motif, a 22 aa transmembrane segment, and a 54 aa cytoplasmicdomain. The high affinity receptor for IL-5 is a complex that consists of the ligand binding IL-5 R alpha and thetransmembrane common beta chain (beta c/CD131) which is shared with the receptor complexes for IL-3 and GM-CSF. IL-5 R alpha binds IL-5 at low affinity and then associates with preformed beta c oligomers to form the signaling-competent receptor complex. IL-5 stimulation of CD34+ hematopoietic progenitor cells induces the up-regulation of transmembrane IL-5 R alpha followed by eosinophilic differentiation and activation. IL-5 R alpha alsopromotes the differentiation of basophils and B cells. Exposure of mature eosinophils to IL-5 attenuates theirIL-5 responsiveness by inducing the down-regulation of surface IL-5 Ralpha and increased production of soluble IL-5 Ralpha.
Product Categories/Family for IL-5RA recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
interleukin-5 receptor subunit alpha
NCBI Official Synonym Full Names
interleukin 5 receptor, alpha
NCBI Official Symbol
Il5ra
NCBI Official Synonym Symbols
Il5r; CD125; CDw125
NCBI Protein Information
interleukin-5 receptor subunit alpha
UniProt Protein Name
Interleukin-5 receptor subunit alpha
UniProt Gene Name
Il5ra
UniProt Synonym Gene Names
Il5r; IL-5 receptor subunit alpha; IL-5R subunit alpha; IL-5R-alpha; IL-5RA
Uniprot Description
IL5RA: This is the receptor for interleukin-5. The alpha chain binds to IL5. Belongs to the type I cytokine receptor family. Type 5 subfamily. 3 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, integral; Receptor, cytokine
Chromosomal Location of Human Ortholog: 6 E1|6 49.19 cM
Biological Process: inflammatory response to antigenic stimulus; regulation of interleukin-5 production
Research Articles on IL-5RA
Similar Products
Product Notes
The IL-5RA il5ra (Catalog #AAA9140013) is a Recombinant Protein produced from Human Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: DLLNHKKFLL LPPVNFTIKA TGLAQVLLHW DPNPDQEQRH VDLEYHVKIN APQEDEYDTR KTESKCVTPL HEGFAASVRT ILKSSHTTLA SSWVSAELKA PPGSPGTSVT NLTCTTHTVV SSHTHLRPYQ VSLRCTWLVG KDAPEDTQYF LYYRFGVLTE KCQEYSRDAL NRNTACWFPR TFINSKGFEQ LAVHINGSSK RAAIKPFDQL FSPLAIDQVN PPRNVTVEIE SNSLYIQWEK PLSAFPDHCF NYELK. It is sometimes possible for the material contained within the vial of "IL-5RA/IL-5 R alpha/CD125, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
