Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human IL-20RA/IL-20 R alpha Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)

IL-20RA/IL-20 R alpha Recombinant Protein | IL-20RA recombinant protein

Recombinant Human IL-20RA/IL-20 R alpha Protein

Gene Names
IL20RA; CRF2-8; IL-20R1; IL-20RA; IL-20R-alpha
Purity
>95% by SDS-PAGE.
Synonyms
IL-20RA/IL-20 R alpha; Recombinant Human IL-20RA/IL-20 R alpha Protein; Interleukin-20 Receptor Subunit Alpha; IL-20 Receptor Subunit Alpha; IL-20R-Alpha; IL-20RA; Cytokine Receptor Class-II Member 8; Cytokine Receptor Family 2 Member 8; CRF2-8; IL-20R1; ZcytoR7; IL20RA; IL-20RA recombinant protein
Ordering
For Research Use Only!
Host
Human Cells
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Sequence
VPCVSGGLPKPANITFLSINMKNVLQWTPPEGLQGVKVTYTVQYFIYGQKKWLNKSECRNINRTYCDLSAETSDYEHQYYAKVKAIWGTKCSKWAESGRFYPFLETQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVSMQQIYSNLKYNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRAQPSEKQCARTLKDQSSEFKAK
Sequence Length
553
Species
Human
Endotoxin
< 1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human IL-20RA/IL-20 R alpha Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)

SDS-Page (Recombinant Human IL-20RA/IL-20 R alpha Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)
Related Product Information for IL-20RA recombinant protein
Description: Recombinant Human IL-20RA/IL-20 R alpha Protein is produced by Human cells expression system. The target protein is expressed with sequence (Val30-Lys250) of human IL-20RA/IL-20 R alpha (Accession #Q9UHF4) fused with a 6xHis tag at the C-terminus.

Background: Interleukin-20 Receptor Subunit alpha (IL20RA) is a single-pass type I membrane protein that is a member of thetype II cytokine receptor family. IL20RA is synthetized a 553 amino acid glycoprotein precursor containing a 29amino acid signal peptide, a 221 amino acid extracellular domain with two fibronectin type-III domains, a 24amino acid transmembrane region, and a 279 amino acid intracellular domain. IL20RA is widely expressed withhighest levels found in skin and testis and high levels in brain. IL20RA forms a heterodimer with IL20RB, andthe complex serves as a receptor for IL19, IL20 and IL24. IL20RA also forms a heterodimer with the unique andspecific receptor IL10RB and functions as the receptor for IL26.
Product Categories/Family for IL-20RA recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
interleukin-20 receptor subunit alpha
NCBI Official Synonym Full Names
interleukin 20 receptor subunit alpha
NCBI Official Symbol
IL20RA
NCBI Official Synonym Symbols
CRF2-8; IL-20R1; IL-20RA; IL-20R-alpha
NCBI Protein Information
interleukin-20 receptor subunit alpha
UniProt Protein Name
Interleukin-20 receptor subunit alpha
UniProt Gene Name
IL20RA
UniProt Synonym Gene Names
IL-20 receptor subunit alpha; IL-20R-alpha; IL-20RA; CRF2-8
UniProt Entry Name
I20RA_HUMAN

NCBI Description

This gene encodes a member of the type II cytokine receptor family. The encoded protein is a subunit of the receptor for interleukin 20, a cytokine that may be involved in epidermal function. The interleukin 20 receptor is a heterodimeric complex consisting of the encoded protein and interleukin 20 receptor beta. This gene and interleukin 20 receptor beta are highly expressed in skin, and are upregulated in psoriasis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]

Uniprot Description

IL20RA: The IL20RA/IL20RB dimer is a receptor for IL19, IL20 and IL24. The IL20RA/IL10RB dimer is a receptor for IL26. Belongs to the type II cytokine receptor family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 6q23.3

Cellular Component: plasma membrane; integral to membrane

Molecular Function: hematopoietin/interferon-class (D200-domain) cytokine receptor activity; interleukin-20 binding

Biological Process: regulation of bone resorption; cytokine and chemokine mediated signaling pathway

Research Articles on IL-20RA

Similar Products

Product Notes

The IL-20RA il20ra (Catalog #AAA9139969) is a Recombinant Protein produced from Human Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: VPCVSGGLPK PANITFLSIN MKNVLQWTPP EGLQGVKVTY TVQYFIYGQK KWLNKSECRN INRTYCDLSA ETSDYEHQYY AKVKAIWGTK CSKWAESGRF YPFLETQIGP PEVALTTDEK SISVVLTAPE KWKRNPEDLP VSMQQIYSNL KYNVSVLNTK SNRTWSQCVT NHTLVLTWLE PNTLYCVHVE SFVPGPPRRA QPSEKQCART LKDQSSEFKA K. It is sometimes possible for the material contained within the vial of "IL-20RA/IL-20 R alpha, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.