Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human IL-12RB1/IL-12 R beta 1/IL-12RB Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)

IL-12RB1/IL-12 R beta 1/IL-12RB Recombinant Protein | IL-12RB1 recombinant protein

Recombinant Human IL-12RB1/IL-12 R beta 1/IL-12RB Protein

Gene Names
IL12RB1; CD212; IMD30; IL12RB; IL-12R-BETA1
Purity
>95% by SDS-PAGE.
Synonyms
IL-12RB1/IL-12 R beta 1/IL-12RB; Recombinant Human IL-12RB1/IL-12 R beta 1/IL-12RB Protein; CD212; IL12RB1; CD212 antigen; IL-12 receptor beta component; IL-12 receptor subunitbeta-1; IL12R; IL-12R subunit beta-1; IL12RB; IL-12RB1; IL-12R-BETA1; IL-12R-beta-1; interleukin-12 receptor beta-1 chain; interleukin-12 receptor subunit beta-1; IL-12RB1 recombinant protein
Ordering
For Research Use Only!
Host
Human Cells
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 um filtered solution of PBS, pH7.4.
Sequence
CRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGT
Sequence Length
660
Species
Human
Endotoxin
< 1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in 1X PBS.
Tag
Fc tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human IL-12RB1/IL-12 R beta 1/IL-12RB Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)

SDS-Page (Recombinant Human IL-12RB1/IL-12 R beta 1/IL-12RB Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)
Related Product Information for IL-12RB1 recombinant protein
Description: Recombinant Human IL-12RB1/IL-12 R beta 1/IL-12RB Protein is produced by Human cells expression system. The target protein is expressed with sequence (Cys24-Glu540) of human IL-12RB1/IL-12 R beta 1/IL-12RB (Accession #P42701) fused with an Fc tag at the C-terminus.

Background: Interleukin12 receptor subunit beta 1 (IL12RB1) is a type I transmembrane protein that belongs to thehemopoietin receptor superfamily. IL12RB1 can spontaneously form homodimers and -oligomers, which areable to bind IL12 with only low affinity. IL12 high affinity receptor complex is composed of two subunitsdesignated IL12RB1 and IL12RB2. While IL12RB1 interacts with the IL-12p40 subunit, IL-12p35 is mainlyconnecting with IL12RB2. This receptor chain is also responsible for transmitting the IL12 signal into the cell.IL12RB1, to the contrary, is also part of the IL23R, where it interacts with the p40 subunit of IL23. IL12RB1 isexpressed in activated T cells, NK cells and B cells.
Product Categories/Family for IL-12RB1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
interleukin-12 receptor subunit beta-1 isoform 3
NCBI Official Synonym Full Names
interleukin 12 receptor subunit beta 1
NCBI Official Symbol
IL12RB1
NCBI Official Synonym Symbols
CD212; IMD30; IL12RB; IL-12R-BETA1
NCBI Protein Information
interleukin-12 receptor subunit beta-1
UniProt Protein Name
Interleukin-12 receptor subunit beta-1
UniProt Gene Name
IL12RB1
UniProt Synonym Gene Names
IL12R; IL12RB; IL-12 receptor subunit beta-1; IL-12R subunit beta-1; IL-12R-beta-1; IL-12RB1
UniProt Entry Name
I12R1_HUMAN

NCBI Description

The protein encoded by this gene is a type I transmembrane protein that belongs to the hemopoietin receptor superfamily. This protein binds to interleukine 12 (IL12) with a low affinity, and is thought to be a part of IL12 receptor complex. This protein forms a disulfide-linked oligomer, which is required for its IL12 binding activity. The coexpression of this and IL12RB2 proteins was shown to lead to the formation of high-affinity IL12 binding sites and reconstitution of IL12 dependent signaling. Mutations in this gene impair the development of interleukin-17-producing T lymphocytes and result in increased susceptibility to mycobacterial and Salmonella infections. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2014]

Uniprot Description

Functions as an interleukin receptor which binds interleukin-12 with low affinity and is involved in IL12 transduction. Associated with IL12RB2 it forms a functional, high affinity receptor for IL12. Associates also with IL23R to form the interleukin-23 receptor which functions in IL23 signal transduction probably through activation of the Jak-Stat signaling cascade.

Research Articles on IL-12RB1

Similar Products

Product Notes

The IL-12RB1 il12rb1 (Catalog #AAA9140106) is a Recombinant Protein produced from Human Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: CRTSECCFQD PPYPDADSGS ASGPRDLRCY RISSDRYECS WQYEGPTAGV SHFLRCCLSS GRCCYFAAGS ATRLQFSDQA GVSVLYTVTL WVESWARNQT EKSPEVTLQL YNSVKYEPPL GDIKVSKLAG QLRMEWETPD NQVGAEVQFR HRTPSSPWKL GDCGPQDDDT ESCLCPLEMN VAQEFQLRRR QLGSQGSSWS KWSSPVCVPP ENPPQPQVRF SVEQLGQDGR RRLTLKEQPT QLELPEGCQG LAPGT. It is sometimes possible for the material contained within the vial of "IL-12RB1/IL-12 R beta 1/IL-12RB, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.