Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant protein Human IL-5 R alpha/CD125 was determined by SDS-PAGE under reducing conditions with Coomassie Blue, showing a band at 42 kDa.)

IL-5 R alpha/CD125 Active Protein | IL5RA active protein

Recombinant Human IL-5 R alpha/CD125 Protein

Gene Names
IL5RA; IL5R; CD125; CDw125; HSIL5R3
Purity
>95% by SDS-PAGE.
Synonyms
IL-5 R alpha/CD125; Recombinant Human IL-5 R alpha/CD125 Protein; CD125; CDw125; HSIL5R3; IL5RA active protein
Ordering
For Research Use Only!
Host
Human Cells
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 um filtered solution of PBS, pH 7.4.
Sequence
DLLPDEKISLLPPVNFTIKVTGLAQVLLQWKPNPDQEQRNVNLEYQVKINAPKEDDYETRITESKCVTILHKGFSASVRTILQNDHSLLASSWASAELHAPPGSPGTSIVNLTCTTNTTEDNYSRLRSYQVSLHCTWLVGTDAPEDTQYFLYYRYGSWTEECQEYSKDTLGRNIACWFPRTFILSKGRDWLAVLVNGSSKHSAIRPFDQLFALHAIDQINPPLNVTAEIEGTRLSIQWEKPVSAFPIHCFDYEVK
Sequence Length
325
Species
Human
Endotoxin
< 1 EU/ug of the protein by LAL method.
Biological Activity
Measured by its ability to inhibit IL-5-dependent proliferation of TF-1 human erythroleukemic cells. The ED50 for this effect is 0.5-2 ug/mL in the presence of 0.5 ng/mL of rhIL-5.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant protein Human IL-5 R alpha/CD125 was determined by SDS-PAGE under reducing conditions with Coomassie Blue, showing a band at 42 kDa.)

SDS-Page (Recombinant protein Human IL-5 R alpha/CD125 was determined by SDS-PAGE under reducing conditions with Coomassie Blue, showing a band at 42 kDa.)
Related Product Information for IL5RA active protein
Description: Recombinant Human IL-5 R alpha/CD125 Protein is produced by Human Cell expression system. The target protein is expressed with sequence (Asp21-Glu335) of human IL-5 R alpha/CD125 (Accession #Q01344) fused with a 6xHis tag at the C-terminus.

Background: This protein is an interleukin 5 specific subunit of a heterodimeric cytokine receptor. The receptor is comprised of a ligand specific alpha subunit and a signal transducing beta subunit shared by the receptors for interleukin 3 (IL3), colony stimulating factor 2 (CSF2/GM-CSF), and interleukin 5 (IL5). The binding of this protein to IL5 depends on the beta subunit. The beta subunit is activated by the ligand binding, and is required for the biological activities of IL5. This protein has been found to interact with syndecan binding protein (syntenin), which is required for IL5 mediated activation of the transcription factor SOX4. Several alternatively spliced transcript variants encoding four distinct isoforms have been reported.
Product Categories/Family for IL5RA active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
NCBI Official Full Name
interleukin 5 receptor alpha transcript variant 7
NCBI Official Synonym Full Names
interleukin 5 receptor subunit alpha
NCBI Official Symbol
IL5RA
NCBI Official Synonym Symbols
IL5R; CD125; CDw125; HSIL5R3
NCBI Protein Information
interleukin-5 receptor subunit alpha
UniProt Protein Name
Interleukin-5 receptor subunit alpha
Protein Family
UniProt Gene Name
IL5RA
UniProt Synonym Gene Names
IL5R; IL-5 receptor subunit alpha; IL-5R subunit alpha; IL-5R-alpha; IL-5RA
UniProt Entry Name
IL5RA_HUMAN

NCBI Description

The protein encoded by this gene is an interleukin 5 specific subunit of a heterodimeric cytokine receptor. The receptor is comprised of a ligand specific alpha subunit and a signal transducing beta subunit shared by the receptors for interleukin 3 (IL3), colony stimulating factor 2 (CSF2/GM-CSF), and interleukin 5 (IL5). The binding of this protein to IL5 depends on the beta subunit. The beta subunit is activated by the ligand binding, and is required for the biological activities of IL5. This protein has been found to interact with syndecan binding protein (syntenin), which is required for IL5 mediated activation of the transcription factor SOX4. Several alternatively spliced transcript variants encoding four distinct isoforms have been reported. [provided by RefSeq, Jul 2011]

Uniprot Description

IL5RA: This is the receptor for interleukin-5. The alpha chain binds to IL5. Belongs to the type I cytokine receptor family. Type 5 subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Receptor, cytokine

Chromosomal Location of Human Ortholog: 3p26-p24

Cellular Component: extracellular space; plasma membrane; integral to membrane

Molecular Function: protein binding; interleukin-5 receptor activity

Biological Process: cell proliferation; regulation of interleukin-5 production; inflammatory response to antigenic stimulus; signal transduction

Research Articles on IL5RA

Similar Products

Product Notes

The IL5RA il5ra (Catalog #AAA9139844) is an Active Protein produced from Human Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: DLLPDEKISL LPPVNFTIKV TGLAQVLLQW KPNPDQEQRN VNLEYQVKIN APKEDDYETR ITESKCVTIL HKGFSASVRT ILQNDHSLLA SSWASAELHA PPGSPGTSIV NLTCTTNTTE DNYSRLRSYQ VSLHCTWLVG TDAPEDTQYF LYYRYGSWTE ECQEYSKDTL GRNIACWFPR TFILSKGRDW LAVLVNGSSK HSAIRPFDQL FALHAIDQIN PPLNVTAEIE GTRLSIQWEK PVSAFPIHCF DYEVK. It is sometimes possible for the material contained within the vial of "IL-5 R alpha/CD125, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.