Follistatin Recombinant Protein | FS recombinant protein

Recombinant Mouse Follistatin Protein

Cat. Num. AAA9141878

• Gene Names: Fst; FS; AL033346
• Purity: >90% by SDS-PAGE.
• Synonyms: Follistatin; Recombinant Mouse Follistatin Protein; AL033346; FS recombinant protein

• Host: HEK293
• Purity/Purification: >90% by SDS-PAGE.
• Form/Format: Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
• Sequence: MVCARHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGKCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPSSSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCGGGKKCLWDSKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEETEEEEEEEDQDYSFPISSILEW
• Sequence Length: 344

• Species: Mouse
• Endotoxin: < 0.1 EU/ug of the protein by LAL method.
• Reconstitution: Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
• Tag: 10xHis tag at the C-terminus
• Preparation and Storage: Store the lyophilized protein at -20 degree C to -80 degree C for long term.; After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Mouse Follistatin Protein was determined by SDS-PAGE with Coomassie Blue, showing bands at 44&50kDa.)

Related Product Information for FS recombinant protein

Recombinant Mouse Follistatin Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Met1-Trp344) of mouse Follistatin (Accession #NP_001288302.1) fused with a 10xHis tag at the C-terminus.

Product Categories/Family for FS recombinant protein

Other Recombinant Protein

NCBI and Uniprot Product Information

• NCBI GI #: 672890584
• NCBI GeneID: 14313
• NCBI Accession #: NP_001288302.1
• NCBI GenBank Nucleotide #: NP_001288302.1
• UniProt Accession #: P47931
• NCBI Official Full Name: follistatin FST315
• NCBI Official Synonym Full Names: follistatin
• NCBI Official Symbol: Fst
• NCBI Official Synonym Symbols: FS; AL033346
• NCBI Protein Information: follistatin
• UniProt Protein Name: Follistatin
• Protein Family: Follistatin
• UniProt Gene Name: Fst
• UniProt Synonym Gene Names: FS
• UniProt Entry Name: FST_MOUSE

NCBI Description

The protein encoded by this gene binds to and negatively regulates activin, as well as other members of the transforming growth factor beta family, and acts to prevent uncontrolled cellular proliferation. This protein also contains a heparin-binding sequence. It is expressed in many of the tissues in which activin is synthesized and is thought to clear activin from the circulation by attachment to the cell surface. Alternative splicing results in multiple transcript variants that encode multiple protein isoforms, including FST315 and FST288, that differ at their C-terminus. Another isoform, FST303 is thought to be produced by proteolytic cleavage of FST315. These isoforms differ in their localization and in their ability to bind heparin. While FST315 is a circulating protein, FST288 is tissue-bound, and FST303 is gonad-specific. While deletion of all isoforms results in embryonic lethality, expression of just FST288 is sufficient for embryonic development, but the resultant mice have fertility defects. [provided by RefSeq, Aug 2014]

Uniprot Description

FST: Binds directly to activin and functions as an activin antagonist. Specific inhibitor of the biosynthesis and secretion of pituitary follicle stimulating hormone (FSH)

Protein type: Secreted, signal peptide; Secreted

Cellular Component: cytoplasm; extracellular region; nucleus

Molecular Function: heparan sulfate proteoglycan binding; activin binding

Biological Process: BMP signaling pathway; positive regulation of hair follicle development; negative regulation of activin receptor signaling pathway; negative regulation of cell differentiation; hair follicle morphogenesis; gamete generation; hemopoietic progenitor cell differentiation; keratinocyte proliferation; negative regulation of transcription from RNA polymerase II promoter; pattern specification process; skeletal development; female gonad development; odontogenesis of dentine-containing teeth