Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human LAG-3/CD223 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 60kDa.)

LAG-3/CD223 Recombinant Protein | LAG3 recombinant protein

Recombinant Human LAG-3/CD223 Protein

Gene Names
LAG3; CD223
Purity
>70% by SDS-PAGE.
Synonyms
LAG-3/CD223; Recombinant Human LAG-3/CD223 Protein; CD223; LAG-3; LAG3 recombinant protein
Ordering
For Research Use Only!
Host
HEK293
Purity/Purification
>70% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
LQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHL
Sequence Length
525
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human LAG-3/CD223 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 60kDa.)

SDS-Page (Recombinant Human LAG-3/CD223 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 60kDa.)
Related Product Information for LAG3 recombinant protein
Recombinant Human LAG-3/CD223 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Leu23-Leu450) of human LAG-3/CD223 (Accession #NP_002277.4) fused with a 6xHis tag at the C-terminus.
Product Categories/Family for LAG3 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
NCBI Official Full Name
Lymphocyte activation gene 3 protein
NCBI Official Synonym Full Names
lymphocyte activating 3
NCBI Official Symbol
LAG3
NCBI Official Synonym Symbols
CD223
NCBI Protein Information
lymphocyte activation gene 3 protein
UniProt Protein Name
Lymphocyte activation gene 3 protein
UniProt Gene Name
LAG3
UniProt Synonym Gene Names
FDC; LAG-3
UniProt Entry Name
LAG3_HUMAN

NCBI Description

Lymphocyte-activation protein 3 belongs to Ig superfamily and contains 4 extracellular Ig-like domains. The LAG3 gene contains 8 exons. The sequence data, exon/intron organization, and chromosomal localization all indicate a close relationship of LAG3 to CD4. [provided by RefSeq, Jul 2008]

Uniprot Description

LAG3: Involved in lymphocyte activation. Binds to HLA class-II antigens.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 12p13.32

Cellular Component: integral to membrane; external side of plasma membrane

Molecular Function: transmembrane receptor activity; antigen binding; MHC class II protein binding

Biological Process: cell surface receptor linked signal transduction; negative regulation of interleukin-2 biosynthetic process; positive regulation of natural killer cell mediated cytotoxicity; negative regulation of T cell activation

Research Articles on LAG3

Similar Products

Product Notes

The LAG3 lag3 (Catalog #AAA9141776) is a Recombinant Protein produced from HEK293 and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: LQPGAEVPVV WAQEGAPAQL PCSPTIPLQD LSLLRRAGVT WQHQPDSGPP AAAPGHPLAP GPHPAAPSSW GPRPRRYTVL SVGPGGLRSG RLPLQPRVQL DERGRQRGDF SLWLRPARRA DAGEYRAAVH LRDRALSCRL RLRLGQASMT ASPPGSLRAS DWVILNCSFS RPDRPASVHW FRNRGQGRVP VRESPHHHLA ESFLFLPQVS PMDSGPWGCI LTYRDGFNVS IMYNLTVLGL EPPTPLTVYA GAGSRVGLPC RLPAGVGTRS FLTAKWTPPG GGPDLLVTGD NGDFTLRLED VSQAQAGTYT CHIHLQEQQL NATVTLAIIT VTPKSFGSPG SLGKLLCEVT PVSGQERFVW SSLDTPSQRS FSGPWLEAQE AQLLSQPWQC QLYQGERLLG AAVYFTELSS PGAQRSGRAP GALPAGHL. It is sometimes possible for the material contained within the vial of "LAG-3/CD223, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.