Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Mouse Lipocalin-2/NGAL? Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 26-27kDa.)

Lipocalin-2/NGAL Recombinant Protein | LCN2 recombinant protein

Recombinant Mouse Lipocalin-2/NGAL Protein

Gene Names
Lcn2; NRL; 24p3; Sip24; AW212229
Purity
>95% by SDS-PAGE.
Synonyms
Lipocalin-2/NGAL; Recombinant Mouse Lipocalin-2/NGAL Protein; NGAL; LCN2; Lipocalin-2; 24p3; MSFI; LCN2 recombinant protein
Ordering
For Research Use Only!
Host
HEK293
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
QDSTQNLIPAPSLLTVPLQPDFRSDQFRGRWYVVGLAGNAVQKKTEGSFTMYSTIYELQENNSYNVTSILVRDQDQGCRYWIRTFVPSSRAGQFTLGNMHRYPQVQSYNVQVATTDYNQFAMVFFRKTSENKQYFKITLYGRTKELSPELKERFTRFAKSLGLKDDNIIFSVPTDQCIDN
Sequence Length
200
Species
Mouse
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
8xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Mouse Lipocalin-2/NGAL? Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 26-27kDa.)

SDS-Page (Recombinant Mouse Lipocalin-2/NGAL? Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 26-27kDa.)
Related Product Information for LCN2 recombinant protein
Recombinant Mouse Lipocalin-2/NGAL  Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Gln21-Asn200) of mouse Lipocalin-2/NGAL  (Accession #NP_032517.1) fused with an 8xHis tag at the C-terminus.
Product Categories/Family for LCN2 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
neutrophil gelatinase-associated lipocalin
NCBI Official Synonym Full Names
lipocalin 2
NCBI Official Symbol
Lcn2
NCBI Official Synonym Symbols
NRL; 24p3; Sip24; AW212229
NCBI Protein Information
neutrophil gelatinase-associated lipocalin
UniProt Protein Name
Neutrophil gelatinase-associated lipocalin
UniProt Gene Name
Lcn2
UniProt Synonym Gene Names
NGAL
UniProt Entry Name
NGAL_MOUSE

Uniprot Description

LCN2: Iron-trafficking protein involved in multiple processes such as apoptosis, innate immunity and renal development. Binds iron through association with 2,5-dihydroxybenzoic acid (2,5- DHBA), a siderophore that shares structural similarities with bacterial enterobactin, and delivers or removes iron from the cell, depending on the context. Iron-bound form (holo-24p3) is internalized following binding to the SLC22A17 (24p3R) receptor, leading to release of iron and subsequent increase of intracellular iron concentration. In contrast, association of the iron-free form (apo-24p3) with the SLC22A17 (24p3R) receptor is followed by association with an intracellular siderophore, iron chelation and iron transfer to the extracellular medium, thereby reducing intracellular iron concentration. Involved in apoptosis due to interleukin-3 (IL3) deprivation: iron-loaded form increases intracellular iron concentration without promoting apoptosis, while iron-free form decreases intracellular iron levels, inducing expression of the proapoptotic protein BCL2L11/BIM, resulting in apoptosis. Involved in innate immunity, possibly by sequestrating iron, leading to limit bacterial growth. Belongs to the calycin superfamily. Lipocalin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Secreted, signal peptide

Cellular Component: cytosol; extracellular region; extracellular space

Molecular Function: iron ion binding; protease binding; protein binding; protein homodimerization activity

Biological Process: innate immune response; positive regulation of cell projection organization and biogenesis; response to drug; response to herbicide; response to virus; siderophore transport

Research Articles on LCN2

Similar Products

Product Notes

The LCN2 lcn2 (Catalog #AAA9141894) is a Recombinant Protein produced from HEK293 and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: QDSTQNLIPA PSLLTVPLQP DFRSDQFRGR WYVVGLAGNA VQKKTEGSFT MYSTIYELQE NNSYNVTSIL VRDQDQGCRY WIRTFVPSSR AGQFTLGNMH RYPQVQSYNV QVATTDYNQF AMVFFRKTSE NKQYFKITLY GRTKELSPEL KERFTRFAKS LGLKDDNIIF SVPTDQCIDN. It is sometimes possible for the material contained within the vial of "Lipocalin-2/NGAL, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.