SDS-Page
Complement C5a anaphylatoxin Recombinant Protein | C5 recombinant protein
Recombinant Pig Complement C5a anaphylatoxin
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Complement C5a anaphylatoxin; Recombinant Pig Complement C5a anaphylatoxin; C5 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-74aa; Full Length
Sequence
MLQKKIEEEAAKYKYAMLKKCCYDGAYRNDDETCEERAARIKIGPKCVKAFKDCCYIANQVRAEQSHKNIQLGR
Sequence Length
74
Production Note
Special Offer: The Yeast host-expressed protein is manufactured from a stock plasmid containing the protein gene. Yeasthost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The Yeast host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select Yeast host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-Page
SDS-Page
Related Product Information for C5 recombinant protein
Derived from proteolytic degradation of complent C5, C5 anaphylatoxin is a mediator of local inflammatory process. Binding to the receptor C5AR1 induces a variety of responses including intracellular calcium release, contraction of smooth muscle, increased vascular permeability, and histamine release from mast cells and basophilic leukocytes. C5a is also a potent chokine which stimulates the locomotion of polymorphonuclear leukocytes and directs their migration toward sites of inflammation.
References
Amino acid sequence of the anaphylatoxin from the fifth component of porcine complement.Gerard C., Hugli T.E.J. Biol. Chem. 255:4710-4715(1980)
Identification of classical anaphylatoxin as the des-Arg form of the C5a molecule
evidence of a modulator role for the oligosaccharide unit in human des-Arg74-C5a.Gerard C., Hugli T.E.Proc. Natl. Acad. Sci. U.S.A. 78:1833-1837(1981)
Three-dimensional structure of porcine C5adesArg from 1H nuclear magnetic resonance data.Williamson M.P., Madison V.S.Biochemistry 29:2895-2905(1990)
NCBI and Uniprot Product Information
NCBI GI #
UniProt Accession #
Molecular Weight
10.6 kDa
NCBI Official Full Name
Complement C5a anaphylatoxin
UniProt Protein Name
Complement C5a anaphylatoxin
Protein Family
UniProt Gene Name
C5
UniProt Entry Name
CO5_PIG
Uniprot Description
Derived from proteolytic degradation of complement C5, C5 anaphylatoxin is a mediator of local inflammatory process. Binding to the receptor C5AR1 induces a variety of responses including intracellular calcium release, contraction of smooth muscle, increased vascular permeability, and histamine release from mast cells and basophilic leukocytes. C5a is also a potent chemokine which stimulates the locomotion of polymorphonuclear leukocytes and directs their migration toward sites of inflammation.
Similar Products
Product Notes
The C5 c5 (Catalog #AAA718153) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-74aa; Full Length. The amino acid sequence is listed below: MLQKKIEEEA AKYKYAMLKK CCYDGAYRND DETCEERAAR IKIGPKCVKA FKDCCYIANQ VRAEQSHKNI QLGR. It is sometimes possible for the material contained within the vial of "Complement C5a anaphylatoxin, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
