Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page

Oxytocin-neurophysin 1 (OXT) Recombinant Protein | OXT recombinant protein

Recombinant Human Oxytocin-neurophysin 1 (OXT)

Gene Names
OXT; OT; OT-NPI; OXT-NPI
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Oxytocin-neurophysin 1 (OXT); Recombinant Human Oxytocin-neurophysin 1 (OXT); Oxytocin-neurophysin 1; OT-NPICleaved into the following 2 chains:; 1. Oxytocin; Ocytocin; Neurophysin 1; OXT recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
32-125aa; Partial
Sequence
AAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR
Sequence Length
125
Species
Homo sapiens (Human)
Production Note
Special Offer: The E Coli, Yeast host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Coli, Yeasthost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli, Yeast host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli, Yeast host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-Page

SDS-Page
Related Product Information for OXT recombinant protein
Neurophysin 1 specifically binds oxytocin.
Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11.6 kDa
NCBI Official Full Name
oxytocin-neurophysin 1 preproprotein
NCBI Official Synonym Full Names
oxytocin/neurophysin I prepropeptide
NCBI Official Symbol
OXT
NCBI Official Synonym Symbols
OT; OT-NPI; OXT-NPI
NCBI Protein Information
oxytocin-neurophysin 1; neurophysin I; oxytocin, prepropeptide; oxytocin, prepro- (neurophysin I); oxytocin-neurophysin I, preproprotein
UniProt Protein Name
Oxytocin-neurophysin 1
Protein Family
UniProt Gene Name
OXT
UniProt Synonym Gene Names
OT; OT-NPI
UniProt Entry Name
NEU1_HUMAN

NCBI Description

This gene encodes a precursor protein that is processed to produce oxytocin and neurophysin I. Oxytocin is a posterior pituitary hormone which is synthesized as an inactive precursor in the hypothalamus along with its carrier protein neurophysin I. Together with neurophysin, it is packaged into neurosecretory vesicles and transported axonally to the nerve endings in the neurohypophysis, where it is either stored or secreted into the bloodstream. The precursor seems to be activated while it is being transported along the axon to the posterior pituitary. This hormone contracts smooth muscle during parturition and lactation. It is also involved in cognition, tolerance, adaptation and complex sexual and maternal behaviour, as well as in the regulation of water excretion and cardiovascular functions. [provided by RefSeq, Dec 2013]

Uniprot Description

OXT: Neurophysin 1 specifically binds oxytocin. Belongs to the vasopressin/oxytocin family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 20p13

Cellular Component: extracellular space; extracellular region; terminal button; secretory granule

Molecular Function: oxytocin receptor binding; neurohypophyseal hormone activity

Biological Process: response to peptide hormone stimulus; response to cAMP; male mating behavior; heart development; response to glucocorticoid stimulus; drinking behavior; positive regulation of female receptivity; female pregnancy; signal transduction; positive regulation of synaptic transmission; response to estradiol stimulus; elevation of cytosolic calcium ion concentration; hyperosmotic salinity response; negative regulation of blood pressure; response to electrical stimulus; response to food; grooming behavior; response to retinoic acid; maternal behavior; regulation of heart rate; eating behavior; response to amphetamine; social behavior; response to ether; sleep; response to cocaine; positive regulation of ossification; memory; response to sucrose stimulus; positive regulation of synaptogenesis; positive regulation of prostaglandin secretion; response to activity; regulation of sensory perception of pain; sperm ejaculation; response to progesterone stimulus; positive regulation of blood pressure

Research Articles on OXT

Similar Products

Product Notes

The OXT oxt (Catalog #AAA956725) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 32-125aa; Partial. The amino acid sequence is listed below: AAPDLDVRKC LPCGPGGKGR CFGPNICCAE ELGCFVGTAE ALRCQEENYL PSPCQSGQKA CGSGGRCAVL GLCCSPDGCH ADPACDAEAT FSQR. It is sometimes possible for the material contained within the vial of "Oxytocin-neurophysin 1 (OXT), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.