3-phytase A Recombinant Protein | phyA recombinant protein

Recombinant Aspergillus niger 3-phytase A

Cat. Num. AAA1119110

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: 3-phytase A; Recombinant Aspergillus niger 3-phytase A; 3 phytase A; Myo-inositol hexakisphosphate phosphohydrolase A; Myo-inositol-hexaphosphate 3-phosphohydrolase A; phyA recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 24-467aa; Full Length of Mature Protein
• Sequence: ASRNQSSCDTVDQGYQCFSETSHLWGQYAPFFSLANESVISPEVPAGCRVTFAQVLSRHGARYPTDSKGKKYSALIEEIQQNATTFDGKYAFLKTYNYSLGADDLTPFGEQELVNSGIKFYQRYESLTRNIVPFIRSSGSSRVIASGKKFIEGFQSTKLKDPRAQPGQSSPKIDVVISEASSSNNTLDPGTCTVFEDSELADTVEANFTATFVPSIRQRLENDLSGVTLTDTEVTYLMDMCSFDTISTSTVDTKLSPFCDLFTHDEWINYDYLQSLKKYYGHGAGNPLGPTQGVGYANELIARLTHSPVHDDTSSNHTLDSSPATFPLNSTLYADFSHDNGIISILFALGLYNGTKPLSTTTVENITQTDGFSSAWTVPFASRLYVEMMQCQAEQEPLVRVLVNDRVVPLHGCPVDALGRCTRDSFVRGLSFARSGGDWAECFA

• Production Note: Special Offer: The Yeast host-expressed protein is manufactured from a stock plasmid containing the protein gene. Yeasthost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The Yeast host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select Yeast host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-Page

Related Product Information for phyA recombinant protein

Catalyzes the hydrolysis of inorganic orthophosphate from phytate.

References

Cloning, characterization and overexpression of the phytase-encoding gene (phyA) of Aspergillus niger.van Hartingsveldt W., van Zeijl C.M.J., Harteveld G.M., Gouka R.J., Suykerbuyk M.E.G., Luiten R.G.M., van Paridon P.A., Selten G.C.M., Veenstra A.E., van Gorcom R.F.M., van den Hondel C.A.M.J.J.Gene 127:87-94(1993) Sequence of the Aspergillus niger (ficuum) phytase gene.Mullaney E.J.Aspergillus ficuum phytase complete primary structure elucidation by chemical sequencing.Ullah A.H.J., Dischinger H.C. Jr.Biochem. Biophys. Res. Commun. 192:747-753(1993) Cyclohexanedione modification of arginine at the active site of Aspergillus ficuum phytase.Ullah A.H.J., Cummins B.J., Dischinger H.C. Jr.Biochem. Biophys. Res. Commun. 178:45-53(1991) Aspergillus ficuum phytase partial primary structure, substrate selectivity, and kinetic characterization.Ullah A.H.J.Prep. Biochem. 18:459-471(1988) Crystal structure of phytase from Aspergillus ficuum at 2.5-A resolution.Kostrewa D., Gruninger-Leitch F., D'Arcy A., Broger C., Mitchell D., van Loon A.P.G.M.Nat. Struct. Biol. 4:185-190(1997)

NCBI and Uniprot Product Information

• NCBI GI #: 464382
• UniProt Accession #: P34752
• Molecular Weight: 50.8 kDa
• NCBI Official Full Name: 3-phytase A
• UniProt Protein Name: 3-phytase A
• Protein Family: 3-phytase
• UniProt Gene Name: phyA
• UniProt Entry Name: PHYA_ASPNG

Uniprot Description

Catalyzes the hydrolysis of inorganic orthophosphate from phytate.