Complement C3 Recombinant Protein | C3 recombinant protein

Recombinant Human Complement C3

Cat. Num. AAA1265331

• Gene Names: C3; ASP; C3a; C3b; AHUS5; ARMD9; CPAMD1; HEL-S-62p
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Complement C3; Recombinant Human Complement C3; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1; C3 recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 26-225aa; Partial
• Sequence: YSIITPNILRLESEETMVLEAHDAQGDVPVTVTVHDFPGKKLVLSSEKTVLTPATNHMGNVTFTIPANREFKSEKGRNKFVTVQATFGTQVVEKVVLVSLQSGYLFIQTDKTIYTPGSTVLYRIFTVNHKLLPVGRTVMVNIENPEGIPVKQDSLSSQNQLGVLPLSWDIPELVNMGQWKIRAYYENSPQQVFSTEFEVK
• Sequence Length: 255

• Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for C3 recombinant protein

C3 plays a central role in the activation of the complent system. Its processing by C3 convertase is the central reaction in both classical and alternative complent pathways. After activation C3b can bind covalently, via its reactive thioester, to cell surface carbohydrates or immune aggregates. Derived from proteolytic degradation of complent C3, C3a anaphylatoxin is a mediator of local inflammatory process. In chronic inflammation, acts as a choattractant for neutrophils. It induces the contraction of smooth muscle, increases vascular permeability and causes histamine release from mast cells and basophilic leukocytes. C3-beta-c: Acts as a choattractant for neutrophils in chronic inflammation. Acylation stimulating protein: adipogenic hormone that stimulates triglyceride (TG) synthesis and glucose transport in adipocytes, regulating fat storage and playing a role in postprandial TG clearance. Appears to stimulate TG synthesis via activation of the PLC, MAPK and AKT signaling pathways. Ligand for C5AR2. Promotes the phosphorylation, ARRB2-mediated internalization and recycling of C5AR2

Product Categories/Family for C3 recombinant protein

Immunology

References

Human complement component C3 cDNA coding sequence and derived primary structure.de Bruijn M.H.L., Fey G.H.Proc. Natl. Acad. Sci. U.S.A. 82:708-712(1985) SeattleSNPs variation discovery resource

NCBI and Uniprot Product Information

• NCBI GI #: 115298678
• NCBI GeneID: 718
• NCBI Accession #: NP_000055.2
• NCBI GenBank Nucleotide #: NM_000064.3
• UniProt Accession #: P01024; A7E236
• Molecular Weight: 26.4 kDa
• NCBI Official Full Name: complement C3 preproprotein
• NCBI Official Synonym Full Names: complement component 3
• NCBI Official Symbol: C3
• NCBI Official Synonym Symbols: ASP; C3a; C3b; AHUS5; ARMD9; CPAMD1; HEL-S-62p
• NCBI Protein Information: complement C3
• UniProt Protein Name: Complement C3
• Protein Family: Complement C3
• UniProt Gene Name: C3
• UniProt Synonym Gene Names: CPAMD1; C3bc; ASP
• UniProt Entry Name: CO3_HUMAN

NCBI Description

Complement component C3 plays a central role in the activation of complement system. Its activation is required for both classical and alternative complement activation pathways. The encoded preproprotein is proteolytically processed to generate alpha and beta subunits that form the mature protein, which is then further processed to generate numerous peptide products. The C3a peptide, also known as the C3a anaphylatoxin, modulates inflammation and possesses antimicrobial activity. Mutations in this gene are associated with atypical hemolytic uremic syndrome and age-related macular degeneration in human patients. [provided by RefSeq, Nov 2015]

Uniprot Description

C3: C3 plays a central role in the activation of the complement system. Its processing by C3 convertase is the central reaction in both classical and alternative complement pathways. After activation C3b can bind covalently, via its reactive thioester, to cell surface carbohydrates or immune aggregates. Defects in C3 are the cause of complement component 3 deficiency (C3D). A rare defect of the complement classical pathway. Patients develop recurrent, severe, pyogenic infections because of ineffective opsonization of pathogens. Some patients may also develop autoimmune disorders, such as arthralgia and vasculitic rashes, lupus-like syndrome and membranoproliferative glomerulonephritis. Genetic variation in C3 is associated with susceptibility to age-related macular degeneration type 9 (ARMD9). ARMD is a multifactorial eye disease and the most common cause of irreversible vision loss in the developed world. In most patients, the disease is manifest as ophthalmoscopically visible yellowish accumulations of protein and lipid that lie beneath the retinal pigment epithelium and within an elastin- containing structure known as Bruch membrane. Defects in C3 are a cause of susceptibility to hemolytic uremic syndrome atypical type 5 (AHUS5). An atypical form of hemolytic uremic syndrome. It is a complex genetic disease characterized by microangiopathic hemolytic anemia, thrombocytopenia, renal failure and absence of episodes of enterocolitis and diarrhea. In contrast to typical hemolytic uremic syndrome, atypical forms have a poorer prognosis, with higher death rates and frequent progression to end-stage renal disease. Susceptibility to the development of atypical hemolytic uremic syndrome can be conferred by mutations in various components of or regulatory factors in the complement cascade system. Other genes may play a role in modifying the phenotype. Increased levels of C3 and its cleavage product ASP, are associated with obesity, diabetes and coronary heart disease. Short-term endurance training reduces baseline ASP levels and subsequently fat storage.

Protein type: Secreted; Secreted, signal peptide; Inhibitor

Chromosomal Location of Human Ortholog: 19p13.3-p13.2

Cellular Component: extracellular region; extracellular space; plasma membrane

Molecular Function: C5L2 anaphylatoxin chemotactic receptor binding; cofactor binding; endopeptidase inhibitor activity; lipid binding; protein binding; receptor binding

Biological Process: blood coagulation; complement activation; complement activation, alternative pathway; complement activation, classical pathway; fatty acid metabolic process; G-protein coupled receptor protein signaling pathway; immune response; inflammatory response; innate immune response; positive regulation of activation of membrane attack complex; positive regulation of angiogenesis; positive regulation of developmental growth; positive regulation of G-protein coupled receptor protein signaling pathway; positive regulation of protein amino acid phosphorylation; positive regulation of type IIa hypersensitivity; regulation of complement activation; regulation of immune response; response to estradiol stimulus; response to glucocorticoid stimulus; response to magnesium ion; response to progesterone stimulus; signal transduction; tolerance induction

Disease: Complement Component 3 Deficiency, Autosomal Recessive; Hemolytic Uremic Syndrome, Atypical, Susceptibility To, 5; Macular Degeneration, Age-related, 9