Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page

TNFSF8 recombinant protein

TNFSF8, human recombinant

Gene Names
TNFSF8; CD153; CD30L; CD30LG
Purity
>=80% by SDS-PAGE
Synonyms
TNFSF8; human recombinant; tumor necrosis factor ligand superfamily member 8; CD153; CD30L; CD30LG; TNFSF8 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
>=80% by SDS-PAGE
Form/Format
Liquid. 0.5mg/ml in 20mM Tris-HCl buffer (pH8.0) containing 10% glycerol and 0.4 M Urea.
Concentration
0.5mg/ml (varies by lot)
Sequence
MGSSHHHHHHSSGLVPRGSHMGSQRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD
Gene Source
Human
Endotoxin
<1.0 EU per 1 microgram of protein
Dry Ice Shipment
Extra charge fee may add to your shipping cost as dry ice is required to ship this product.
Preparation and Storage
Store at -80 degree C.
Centrifuge the vial prior to opening.
Shipping: Dry Ice
Shelf life: ~12 months

SDS-Page

SDS-Page
Related Product Information for TNFSF8 recombinant protein
TNFSF8 is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF8/CD30, which is a cell surface antigen and a marker for Hodgkin lymphoma and related hematologic malignancies. The engagement of this cytokine expressed on B cell surface plays an inhibitory role in modulating Ig class switch. TNFSF8 was shown to enhance cell proliferation of some lymphoma cell lines, while to induce cell death and reduce cell proliferation of other lymphoma cell lines. The pleiotropic biologic activities of this cytokine on different CD30+ lymphoma cell lines may play a pathophysiologic role in Hodgkin's and some non-Hodgkin's lymphomas. Recombinant human TNFSF8 protein, fused to His-tag at N-terminus, was expressed in E Coli.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
944
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26,017 Da
NCBI Official Full Name
tumor necrosis factor ligand superfamily member 8 isoform 1
NCBI Official Synonym Full Names
tumor necrosis factor (ligand) superfamily, member 8
NCBI Official Symbol
TNFSF8
NCBI Official Synonym Symbols
CD153; CD30L; CD30LG
NCBI Protein Information
tumor necrosis factor ligand superfamily member 8; CD30-L; CD30 ligand; CD153 antigen; CD30 antigen ligand
UniProt Protein Name
Tumor necrosis factor ligand superfamily member 8
UniProt Gene Name
TNFSF8
UniProt Synonym Gene Names
CD30L; CD30LG; CD30-L
UniProt Entry Name
TNFL8_HUMAN

NCBI Description

The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF8/CD30, which is a cell surface antigen and a marker for Hodgkin lymphoma and related hematologic malignancies. The engagement of this cytokine expressed on B cell surface plays an inhibitory role in modulating Ig class switch. This cytokine was shown to enhance cell proliferation of some lymphoma cell lines, while to induce cell death and reduce cell proliferation of other lymphoma cell lines. The pleiotropic biologic activities of this cytokine on different CD30+ lymphoma cell lines may play a pathophysiologic role in Hodgkin's and some non-Hodgkin's lymphomas. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011]

Uniprot Description

TNFSF8: Cytokine that binds to TNFRSF8/CD30. Induces proliferation of T-cells. Belongs to the tumor necrosis factor family.

Protein type: Apoptosis; Cytokine; Membrane protein, integral

Chromosomal Location of Human Ortholog: 9q33

Cellular Component: extracellular space; integral to plasma membrane

Molecular Function: cytokine activity; tumor necrosis factor receptor binding; receptor binding

Biological Process: cell proliferation; CD8-positive, alpha-beta T cell differentiation; defense response to Gram-positive bacterium; cell-cell signaling; apoptosis; immune response; positive regulation of transcription from RNA polymerase II promoter; signal transduction

Research Articles on TNFSF8

Similar Products

Product Notes

The TNFSF8 tnfsf8 (Catalog #AAA847121) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MGSSHHHHHH SSGLVPRGSH MGSQRTDSIP NSPDNVPLKG GNCSEDLLCI LKRAPFKKSW AYLQVAKHLN KTKLSWNKDG ILHGVRYQDG NLVIQFPGLY FIICQLQFLV QCPNNSVDLK LELLINKHIK KQALVTVCES GMQTKHVYQN LSQFLLDYLQ VNTTISVNVD TFQYIDTSTF PLENVLSIFL YSNSD. It is sometimes possible for the material contained within the vial of "TNFSF8, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.