Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (PYGM monoclonal antibody (M10), clone 2C4. Western Blot analysis of PYGM expression in HepG2.)

Mouse PYGM Monoclonal Antibody | anti-PYGM antibody

PYGM (Phosphorylase, glycogen, Muscle) (Biotin)

Applications
Western Blot
Purity
Purified
Synonyms
PYGM; Monoclonal Antibody; PYGM (Phosphorylase; glycogen; Muscle) (Biotin); Phosphorylase; Muscle; anti-PYGM antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2C4
Specificity
Recognizes PYGM.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-PYGM antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PYGM (NP_005600.1, 734aa-842aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DRIPELRQVIEQLSSGFFSPKQPDLFKDIVNMLMHHDRFKVFADYEDYIKCQEKVSALYKNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSRQRLPAPDEAI
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(PYGM monoclonal antibody (M10), clone 2C4. Western Blot analysis of PYGM expression in HepG2.)

Western Blot (WB) (PYGM monoclonal antibody (M10), clone 2C4. Western Blot analysis of PYGM expression in HepG2.)

Western Blot (WB)

(PYGM monoclonal antibody (M10), clone 2C4. Western Blot analysis of PYGM expression in NIH/3T3.)

Western Blot (WB) (PYGM monoclonal antibody (M10), clone 2C4. Western Blot analysis of PYGM expression in NIH/3T3.)

Western Blot (WB)

(PYGM monoclonal antibody (M10), clone 2C4. Western Blot analysis of PYGM expression in PC-12.)

Western Blot (WB) (PYGM monoclonal antibody (M10), clone 2C4. Western Blot analysis of PYGM expression in PC-12.)

Western Blot (WB)

(PYGM monoclonal antibody (M10), clone 2C4. Western Blot analysis of PYGM expression in Raw 264.7.)

Western Blot (WB) (PYGM monoclonal antibody (M10), clone 2C4. Western Blot analysis of PYGM expression in Raw 264.7.)

Testing Data

(Detection limit for recombinant GST tagged PYGM is 1 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PYGM is 1 ng/ml as a capture antibody.)
Related Product Information for anti-PYGM antibody
This gene encodes a muscle enzyme involved in glycogenolysis. Highly similar enzymes encoded by different genes are found in liver and brain. Mutations in this gene are associated with McArdle disease (myophosphorylase deficiency), a glycogen storage disease of muscle. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-PYGM antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
97,092 Da
NCBI Official Full Name
glycogen phosphorylase, muscle form isoform 1
NCBI Official Synonym Full Names
phosphorylase, glycogen, muscle
NCBI Official Symbol
PYGM
NCBI Protein Information
glycogen phosphorylase, muscle form; myophosphorylase
UniProt Protein Name
Glycogen phosphorylase, muscle form
Protein Family
UniProt Gene Name
PYGM
UniProt Entry Name
PYGM_HUMAN

NCBI Description

This gene encodes a muscle enzyme involved in glycogenolysis. Highly similar enzymes encoded by different genes are found in liver and brain. Mutations in this gene are associated with McArdle disease (myophosphorylase deficiency), a glycogen storage disease of muscle. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Sep 2009]

Uniprot Description

PYGM: an important allosteric enzyme in carbohydrate metabolism. Enzymes from different sources differ in their regulatory mechanisms and in their natural substrates. However, all known phosphorylases share catalytic and structural properties. Dimers associate into a tetramer to form the enzymatically active phosphorylase A. Phosphorylation of Ser-14 converts phosphorylase B (unphosphorylated) to phosphorylase A.

Protein type: Phosphorylase; Carbohydrate Metabolism - starch and sucrose; Transferase; Endoplasmic reticulum; EC 2.4.1.1

Chromosomal Location of Human Ortholog: 11q12-q13.2

Cellular Component: cytosol

Molecular Function: glycogen phosphorylase activity; nucleotide binding; pyridoxal phosphate binding

Biological Process: glycogen metabolic process; glycogen catabolic process; carbohydrate metabolic process; glucose metabolic process; pathogenesis

Disease: Glycogen Storage Disease V

Research Articles on PYGM

Similar Products

Product Notes

The PYGM pygm (Catalog #AAA6173705) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PYGM can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PYGM pygm for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PYGM, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.