CD153 recombinant protein

CD153 Recombinant Protein

Cat. Num. AAA3003492

• Gene Names: TNFSF8; CD153; CD30L; CD30LG
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Synonyms: CD153; CD153 Recombinant Protein; CD153 recombinant protein

• Host: E Coli
• Purity/Purification: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Form/Format: PBS, 4M Urea, PH7.4
• Concentration: >=0.5mg/ml (varies by lot)
• Sequence: QRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD

• Tag: His-tag in C-terminal
• Expression Vector: pet-22b(+)
• BP: 528
• Restriction Site: NdeI-XhoI
• Preparation and Storage: Store at 4 degee C for short term. Aliquot and store at -20 degee C long term. Avoid freeze-thaw cycles.

Testing Data

()

Related Product Information for CD153 recombinant protein

Background: Cytokine that binds to TNFRSF8/CD30. Induces proliferation of T-cells.

NCBI and Uniprot Product Information

• NCBI GI #: 4507607
• NCBI GeneID: 944
• NCBI Accession #: NP_001235.1
• NCBI GenBank Nucleotide #: NM_001244.3
• UniProt Accession #: P32971; O43404
• Molecular Weight: 26,017 Da
• NCBI Official Full Name: tumor necrosis factor ligand superfamily member 8 isoform 1
• NCBI Official Synonym Full Names: tumor necrosis factor (ligand) superfamily, member 8
• NCBI Official Symbol: TNFSF8
• NCBI Official Synonym Symbols: CD153; CD30L; CD30LG
• NCBI Protein Information: tumor necrosis factor ligand superfamily member 8; CD30-L; CD30 ligand; CD153 antigen; CD30 antigen ligand
• UniProt Protein Name: Tumor necrosis factor ligand superfamily member 8
• UniProt Gene Name: TNFSF8
• UniProt Synonym Gene Names: CD30L; CD30LG; CD30-L
• UniProt Entry Name: TNFL8_HUMAN

NCBI Description

The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF8/CD30, which is a cell surface antigen and a marker for Hodgkin lymphoma and related hematologic malignancies. The engagement of this cytokine expressed on B cell surface plays an inhibitory role in modulating Ig class switch. This cytokine was shown to enhance cell proliferation of some lymphoma cell lines, while to induce cell death and reduce cell proliferation of other lymphoma cell lines. The pleiotropic biologic activities of this cytokine on different CD30+ lymphoma cell lines may play a pathophysiologic role in Hodgkin's and some non-Hodgkin's lymphomas. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011]

Uniprot Description

TNFSF8: Cytokine that binds to TNFRSF8/CD30. Induces proliferation of T-cells. Belongs to the tumor necrosis factor family.

Protein type: Apoptosis; Cytokine; Membrane protein, integral

Chromosomal Location of Human Ortholog: 9q33

Cellular Component: extracellular space; integral to plasma membrane

Molecular Function: cytokine activity; tumor necrosis factor receptor binding; receptor binding

Biological Process: cell proliferation; CD8-positive, alpha-beta T cell differentiation; defense response to Gram-positive bacterium; cell-cell signaling; apoptosis; immune response; positive regulation of transcription from RNA polymerase II promoter; signal transduction