Tumor Necrosis Factor Receptor Superfamily Member 14 (Tnfrsf14) Active Protein | Tnfrsf14 active protein
Recombinant Mouse Tumor Necrosis Factor Receptor Superfamily Member 14 (Tnfrsf14), Partial
Gene Names
Tnfrsf14; TR2; Atar; HveA; Hvem; Tnfrs14
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Tumor Necrosis Factor Receptor Superfamily Member 14 (Tnfrsf14); Recombinant Mouse Tumor Necrosis Factor Receptor Superfamily Member 14 (Tnfrsf14); Partial; Tnfrsf14; Herpesvirus entry mediator; HVEM; TR2; TNF receptor-like molecule; ATAR; another TRAF-associated receptor; Tumor necrosis factor receptor superfamily member 14; Tnfrsf14 active protein
Host
Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 mum Filtered 20 mM PB, 150 mM NaCl, pH 7.4
Sequence Positions
39-207aa; Partial
Sequence
QPSCRQEEFLVGDECCPMCNPGYHVKQVCSEHTGTVCAPCPPQTYTAHANGLSKCLPCGVCDPDMGLLTWQECSSWKDTVCRCIPGYFCENQDGSHCSTCLQHTTCPPGQRVEKRGTHDQDTVCADCLTGTFSLGGTQEECLPWTNCSAFQQEVRRGTNSTDTTCSSQV
Sequence Length
275
Species
Mouse
Tag
C-terminal FC-tagged
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to bind Human BTLA in functional ELISA is typically 1.17 ug/ml
Classification
Drug Target
Subdivision
Immune Checkpoint
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for Tnfrsf14 active protein
Mouse Protein Tnfrsf14, is a type I transmembrane protein belonging to the TNF receptor superfamily. It is tumor necrosis factor receptor superfamily member 14 and expressed on the surface of T cells during the resting state. Interaction of HVEM with TNF family member LIGHT co-stimulates T cells and promotes inflammation. HVEM also triggers inhibitory signaling cascade in effector T (Teff) cells and regulatory T cells (Tregs) as a ligand of B and T lymphocyte attenuator. Tnfrsf14 is detected in peripheral blood T cells, B cells, monocytes and in various tissues enriched in lymphoid cells. It has demonstrated that HVEM Ig is able to exert a significant antiviral effect against HSV-1 infection in vivo.
Product Categories/Family for Tnfrsf14 active protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
45.6 kDa
NCBI Official Full Name
Tumor necrosis factor receptor superfamily member 14
NCBI Official Synonym Full Names
tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator)
NCBI Official Symbol
Tnfrsf14
NCBI Official Synonym Symbols
TR2; Atar; HveA; Hvem; Tnfrs14
NCBI Protein Information
tumor necrosis factor receptor superfamily member 14
UniProt Protein Name
Protein Tnfrsf14
Protein Family
UniProt Gene Name
Tnfrsf14
UniProt Entry Name
Q80WM9_MOUSE
Research Articles on Tnfrsf14
Similar Products
Product Notes
The Tnfrsf14 tnfrsf14 (Catalog #AAA7115128) is an Active Protein produced from Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 39-207aa; Partial. The amino acid sequence is listed below: QPSCRQEEFL VGDECCPMCN PGYHVKQVCS EHTGTVCAPC PPQTYTAHAN GLSKCLPCGV CDPDMGLLTW QECSSWKDTV CRCIPGYFCE NQDGSHCSTC LQHTTCPPGQ RVEKRGTHDQ DTVCADCLTG TFSLGGTQEE CLPWTNCSAF QQEVRRGTNS TDTTCSSQV. It is sometimes possible for the material contained within the vial of "Tumor Necrosis Factor Receptor Superfamily Member 14 (Tnfrsf14), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
