Catechol O-methyltransferase Recombinant Protein | COMT recombinant protein

Catechol O-methyltransferase

Cat. Num. AAA7042574

• Gene Names: COMT; HEL-S-98n
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Catechol O-methyltransferase; COMT recombinant protein

• Host: Cell Free Expression
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 1-271aa; full length protein
• Sequence: MPEAPPLLLAAVLLGLVLLVVLLLLLRHWGWGLCLIGWNEFILQPIHNLLMGDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP
• Sequence Length: Full Length Protein

• Species: Homo sapiens (Human)
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for COMT recombinant protein

This is a recombinant transmembrane protein expressed in a cell-free expression system.

Product Categories/Family for COMT recombinant protein

Transmembrane Protein

NCBI and Uniprot Product Information

• NCBI GI #: 4502969
• NCBI GeneID: 1312
• NCBI Accession #: NP_000745.1
• NCBI GenBank Nucleotide #: NM_000754.3
• UniProt Accession #: P21964; Q6IB07; Q6ICE6; Q9BWC7; A8MPV9
• Molecular Weight: 24,449 Da
• NCBI Official Full Name: catechol O-methyltransferase isoform MB-COMT
• NCBI Official Synonym Full Names: catechol-O-methyltransferase
• NCBI Official Symbol: COMT
• NCBI Official Synonym Symbols: HEL-S-98n
• NCBI Protein Information: catechol O-methyltransferase
• UniProt Protein Name: Catechol O-methyltransferase
• Protein Family: Catechol O-methyltransferase
• UniProt Gene Name: COMT
• UniProt Entry Name: COMT_HUMAN

NCBI Description

Catechol-O-methyltransferase catalyzes the transfer of a methyl group from S-adenosylmethionine to catecholamines, including the neurotransmitters dopamine, epinephrine, and norepinephrine. This O-methylation results in one of the major degradative pathways of the catecholamine transmitters. In addition to its role in the metabolism of endogenous substances, COMT is important in the metabolism of catechol drugs used in the treatment of hypertension, asthma, and Parkinson disease. COMT is found in two forms in tissues, a soluble form (S-COMT) and a membrane-bound form (MB-COMT). The differences between S-COMT and MB-COMT reside within the N-termini. Several transcript variants are formed through the use of alternative translation initiation sites and promoters. [provided by RefSeq, Sep 2008]

Uniprot Description

COMT: Catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones. Also shortens the biological half-lives of certain neuroactive drugs, like L-DOPA, alpha-methyl DOPA and isoproterenol. Belongs to the mammalian catechol-O-methyltransferase family. 2 isoforms of the human protein are produced by alternative initiation.

Protein type: Methyltransferase; Amino Acid Metabolism - tyrosine; Membrane protein, integral; EC 2.1.1.6

Chromosomal Location of Human Ortholog: 22q11.21

Cellular Component: cytosol; membrane; plasma membrane

Molecular Function: catechol O-methyltransferase activity; methyltransferase activity; O-methyltransferase activity; protein binding

Biological Process: methylation

Disease: Panic Disorder 1; Schizophrenia