Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page

Catechol O-methyltransferase Recombinant Protein | COMT recombinant protein

Recombinant Human Catechol O-methyltransferase

Gene Names
COMT; HEL-S-98n
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Catechol O-methyltransferase; Recombinant Human Catechol O-methyltransferase; COMT recombinant protein
Ordering
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
52-271
Sequence
GDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP
Sequence Length
271
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-Page

SDS-Page
Related Product Information for COMT recombinant protein
Catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones. Also shortens the biological half-lives of certain neuroactive drugs, like L-DOPA, alpha-methyl DOPA and isoproterenol.
Product Categories/Family for COMT recombinant protein
References
Cloning and characterization of human placental catechol-O-methyltransferase cDNA.Lundstroem K., Salminen M., Jalanko A., Savolainen R., Ulmanen I.DNA Cell Biol. 10:181-189(1991)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28.4kD
NCBI Official Full Name
catechol O-methyltransferase isoform MB-COMT
NCBI Official Synonym Full Names
catechol-O-methyltransferase
NCBI Official Symbol
COMT
NCBI Official Synonym Symbols
HEL-S-98n
NCBI Protein Information
catechol O-methyltransferase
UniProt Protein Name
Catechol O-methyltransferase
UniProt Gene Name
COMT
UniProt Entry Name
COMT_HUMAN

NCBI Description

Catechol-O-methyltransferase catalyzes the transfer of a methyl group from S-adenosylmethionine to catecholamines, including the neurotransmitters dopamine, epinephrine, and norepinephrine. This O-methylation results in one of the major degradative pathways of the catecholamine transmitters. In addition to its role in the metabolism of endogenous substances, COMT is important in the metabolism of catechol drugs used in the treatment of hypertension, asthma, and Parkinson disease. COMT is found in two forms in tissues, a soluble form (S-COMT) and a membrane-bound form (MB-COMT). The differences between S-COMT and MB-COMT reside within the N-termini. Several transcript variants are formed through the use of alternative translation initiation sites and promoters. [provided by RefSeq, Sep 2008]

Uniprot Description

COMT: Catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones. Also shortens the biological half-lives of certain neuroactive drugs, like L-DOPA, alpha-methyl DOPA and isoproterenol. Belongs to the mammalian catechol-O-methyltransferase family. 2 isoforms of the human protein are produced by alternative initiation.

Protein type: Amino Acid Metabolism - tyrosine; Membrane protein, integral; EC 2.1.1.6; Methyltransferase

Chromosomal Location of Human Ortholog: 22q11.21

Cellular Component: axon; cytosol; dendritic spine; integral to membrane; membrane; mitochondrion; plasma membrane; postsynaptic membrane

Molecular Function: catechol O-methyltransferase activity; magnesium ion binding; O-methyltransferase activity; protein binding

Biological Process: cellular response to phosphate starvation; developmental process; dopamine catabolic process; estrogen metabolic process; female pregnancy; learning; methylation; negative regulation of dopamine metabolic process; negative regulation of smooth muscle cell proliferation; neurotransmitter biosynthetic process; neurotransmitter catabolic process; positive regulation of homocysteine metabolic process; regulation of sensory perception of pain; reproductive process in a multicellular organism; response to drug; response to lipopolysaccharide; response to organic cyclic substance; response to pain; short-term memory; synaptic transmission; xenobiotic metabolic process

Disease: Panic Disorder 1; Schizophrenia

Research Articles on COMT

Similar Products

Product Notes

The COMT comt (Catalog #AAA1265250) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 52-271. The amino acid sequence is listed below: GDTKEQRILN HVLQHAEPGN AQSVLEAIDT YCEQKEWAMN VGDKKGKIVD AVIQEHQPSV LLELGAYCGY SAVRMARLLS PGARLITIEI NPDCAAITQR MVDFAGVKDK VTLVVGASQD IIPQLKKKYD VDTLDMVFLD HWKDRYLPDT LLLEECGLLR KGTVLLADNV ICPGAPDFLA HVRGSSCFEC THYQSFLEYR EVVDGLEKAI YKGPGSEAGP. It is sometimes possible for the material contained within the vial of "Catechol O-methyltransferase, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.