Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence analysis of HeLa cells using ALAS1 antibody. Blue: DAPI for nuclear staining.)

Rabbit ALAS1 Polyclonal Antibody | anti-ALAS1 antibody

ALAS1 Polyclonal Antibody

Gene Names
ALAS1; ALAS; MIG4; ALAS3; ALASH; ALAS-H
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunofluorescence
Purity
Affinity Purification
Synonyms
ALAS1; Polyclonal Antibody; ALAS1 Polyclonal Antibody; ALAS; ALAS-H; ALAS3; ALASH; MIG4; anti-ALAS1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MESVVRRCPFLSRVPQAFLQKAGKSLLFYAQNCPKMMEVGAKPAPRALSTAAVHYQQIKETPPASEKDKTAKAKVQQTPDGSQQSPDGTQLPSGHPLPATSQGTASKCPFLAAQMNQRGSSVFCKASLELQEDVQEMNAVRKEVAETSAGPSVVSVKTDGGDPSGLLKNFQDIMQKQRPERVSHLLQDNLPKSVSTFQYDRFFEKKIDEKKNDHTYRVFKTVNRRAHIFPMADDYSDSLITKKQVSVWCS
Sequence Length
640
Applicable Applications for anti-ALAS1 antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
WB: 1:500 - 1:2000
IF: 1:50 - 1:200
Immunogen
Recombinant protein of human ALAS1
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Mitochondrion matrix
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

Immunofluorescence (IF)

(Immunofluorescence analysis of HeLa cells using ALAS1 antibody. Blue: DAPI for nuclear staining.)

Immunofluorescence (IF) (Immunofluorescence analysis of HeLa cells using ALAS1 antibody. Blue: DAPI for nuclear staining.)
Related Product Information for anti-ALAS1 antibody
This gene encodes the mitochondrial enzyme which is catalyzes the rate-limiting step in heme (iron-protoporphyrin) biosynthesis. The enzyme encoded by this gene is the housekeeping enzyme; a separate gene encodes a form of the enzyme that is specific for erythroid tissue. The level of the mature encoded protein is regulated by heme: high levels of heme down-regulate the mature enzyme in mitochondria while low heme levels up-regulate. A pseudogene of this gene is located on chromosome 12. Alternative splicing results in multiple transcript variants encoding different isoforms.
Product Categories/Family for anti-ALAS1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
211
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12kDa/70kDa
NCBI Official Full Name
5-aminolevulinate synthase, nonspecific, mitochondrial isoform 1
NCBI Official Synonym Full Names
5'-aminolevulinate synthase 1
NCBI Official Symbol
ALAS1
NCBI Official Synonym Symbols
ALAS; MIG4; ALAS3; ALASH; ALAS-H
NCBI Protein Information
5-aminolevulinate synthase, nonspecific, mitochondrial
UniProt Protein Name
5-aminolevulinate synthase, nonspecific, mitochondrial
Protein Family
UniProt Gene Name
ALAS1
UniProt Synonym Gene Names
ALAS3; ALASH; ALAS-H

NCBI Description

This gene encodes the mitochondrial enzyme which is catalyzes the rate-limiting step in heme (iron-protoporphyrin) biosynthesis. The enzyme encoded by this gene is the housekeeping enzyme; a separate gene encodes a form of the enzyme that is specific for erythroid tissue. The level of the mature encoded protein is regulated by heme: high levels of heme down-regulate the mature enzyme in mitochondria while low heme levels up-regulate. A pseudogene of this gene is located on chromosome 12. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jan 2015]

Uniprot Description

MiscellaneousThere are two delta-ALA synthases in vertebrates: an erythroid- specific form and one (housekeeping) which is expressed in all tissues.

Research Articles on ALAS1

Similar Products

Product Notes

The ALAS1 alas1 (Catalog #AAA9133502) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ALAS1 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ALAS1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). WB: 1:500 - 1:2000 IF: 1:50 - 1:200. Researchers should empirically determine the suitability of the ALAS1 alas1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MESVVRRCPF LSRVPQAFLQ KAGKSLLFYA QNCPKMMEVG AKPAPRALST AAVHYQQIKE TPPASEKDKT AKAKVQQTPD GSQQSPDGTQ LPSGHPLPAT SQGTASKCPF LAAQMNQRGS SVFCKASLEL QEDVQEMNAV RKEVAETSAG PSVVSVKTDG GDPSGLLKNF QDIMQKQRPE RVSHLLQDNL PKSVSTFQYD RFFEKKIDEK KNDHTYRVFK TVNRRAHIFP MADDYSDSLI TKKQVSVWCS. It is sometimes possible for the material contained within the vial of "ALAS1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.