Mouse anti-Human PIP4K2C Monoclonal Antibody | anti-PIP4K2C antibody

PIP4K2C (Phosphatidylinositol 5-phosphate 4-kinase Type-2 gamma, Phosphatidylinositol 5-phosphate 4-kinase Type II gamma, PI(5)P 4-kinase Type II gamma, PIP4KII-gamma, PIP5K2C, FLJ22055)

Cat. Num. AAA641503

• Reactivity: Human
• Applications: ELISA
• Purity: Ascites; Ascites
• Synonyms: PIP4K2C; Monoclonal Antibody; PIP4K2C (Phosphatidylinositol 5-phosphate 4-kinase Type-2 gamma; Phosphatidylinositol 5-phosphate 4-kinase Type II gamma; PI(5)P 4-kinase Type II gamma; PIP4KII-gamma; PIP5K2C; FLJ22055); Anti -PIP4K2C (Phosphatidylinositol 5-phosphate 4-kinase Type-2 gamma; anti-PIP4K2C antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG
• Clone Number: 3A4
• Specificity: Recognizes human PIP5K2C.
• Purity/Purification: Ascites; Ascites
• Form/Format: Supplied as a liquid in ascites fluid.
• Sequence: DGDCSLTGPPALVGSYGTSPEGIGGYIHSHRPLGPGEFESFIDVYAIRSAEGAPQKEVYFMGLIDILTQYDA

• Applicable Applications for anti-PIP4K2C antibody: ELISA (EL/EIA)
• Application Notes: Suitable for use in ELISA.
• Immunogen: Partial recombinant corresponding to aa310-382 from PIP5K2C (NP_079055) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Related Product Information for anti-PIP4K2C antibody

Protein kinases are enzymes that transfer a phosphate group from a phosphate donor, generally the g phosphate of ATP, onto an acceptor amino acid in a substrate protein. By this basic mechanism, protein kinases mediate most of the signal transduction in eukaryotic cells, regulating cellular metabolism, transcription, cell cycle progression, cytoskeletal rearrangement and cell movement, apoptosis, and differentiation. With more than 500 gene products, the protein kinase family is one of the largest families of proteins in eukaryotes. The family has been classified in 8 major groups based on sequence comparison of their tyrosine (PTK) or serine/threonine (STK) kinase catalytic domains.

Product Categories/Family for anti-PIP4K2C antibody

Antibodies; Abs to Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 115495901
• NCBI GeneID: 540005
• NCBI Accession #: NP_001069664.1
• NCBI GenBank Nucleotide #: NM_001076196.1
• UniProt Accession #: Q0P5F7
• Molecular Weight: 47,142 Da
• NCBI Official Full Name: phosphatidylinositol 5-phosphate 4-kinase type-2 gamma
• NCBI Official Synonym Full Names: phosphatidylinositol-5-phosphate 4-kinase, type II, gamma
• NCBI Official Symbol: PIP4K2C
• NCBI Protein Information: phosphatidylinositol 5-phosphate 4-kinase type-2 gamma; PIP4KII-gamma; PI(5)P 4-kinase type II gamma; phosphatidylinositol-5-phosphate 4-kinase type-2 gamma; phosphatidylinositol 5-phosphate 4-kinase type II gamma; phosphatidylinositol-5-phosphate 4-kinase type II gamma
• UniProt Protein Name: Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma
• Protein Family: Phosphatidylinositol 5-phosphate 4-kinase
• UniProt Gene Name: PIP4K2C
• UniProt Synonym Gene Names: PIP5K2C; PI(5)P 4-kinase type II gamma
• UniProt Entry Name: PI42C_BOVIN

Uniprot Description

Function: May play an important role in the production of Phosphatidylinositol bisphosphate (PIP2), in the endoplasmic reticulum

By similarity.

Catalytic activity: ATP + 1-phosphatidyl-1D-myo-inositol 5-phosphate = ADP + 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate.

Subcellular location: Cytoplasm. Membrane. Note: Mostly found in the cytosol and surrounding plasma membrane. However, its presence in the endoplasmic reticulum seems to be a prerequisite for PIP2 synthesis

By similarity.

Post-translational modification: Phosphorylated

By similarity.

Sequence similarities: Contains 1 PIPK domain.