<
Western Blot (WB)
(Western Blot detection against Immunogen (37.11kD).)
Mouse anti-Human PIK3R4 Monoclonal Antibody | anti-Pik3r4 antibody
PIK3R4 (Phosphoinositide 3-kinase Regulatory Subunit 4, PI3-kinase Regulatory Subunit 4, PI3-kinase p150 Subunit, Phosphoinositide 3-kinase Adaptor Protein, MGC102700, p150, VPS15)
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
PIK3R4; Monoclonal Antibody; PIK3R4 (Phosphoinositide 3-kinase Regulatory Subunit 4; PI3-kinase Regulatory Subunit 4; PI3-kinase p150 Subunit; Phosphoinositide 3-kinase Adaptor Protein; MGC102700; p150; VPS15); Anti -PIK3R4 (Phosphoinositide 3-kinase Regulatory Subunit 4; anti-Pik3r4 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D4
Specificity
Recognizes human PIK3R4.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
AGSDMKIRFWDLAYPERSYVVAGSTSSPSVSYYRKIIEGTEVVQEIQNKQKVGPSDDTPRRGPESLPVGHHDIITDVATFQTTQGFIVTASRDGIVKVWK
Applicable Applications for anti-Pik3r4 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa1259-1359 from human PIK3R4 (NP_055417) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (37.11kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (37.11kD).)
Western Blot (WB)
(PIK3R4 monoclonal antibody, Western Blot analysis of PIK3R4 expression in HeLa.)
Western Blot (WB)
(PIK3R4 monoclonal antibody, Western Blot analysis of PIK3R4 expression in HeLa.)
Western Blot (WB)
(Western Blot analysis of PIK3R4 expression in transfected 293T cell line by PIK3R4 monoclonal antibody.|Lane 1: PIK3R4 transfected lysate (153.1kD).|Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of PIK3R4 expression in transfected 293T cell line by PIK3R4 monoclonal antibody.|Lane 1: PIK3R4 transfected lysate (153.1kD).|Lane 2: Non-transfected lysate.)
Testing Data
(Detection limit for recombinant GST tagged PIK3R4 is ~0.3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged PIK3R4 is ~0.3ng/ml as a capture antibody.)
Western Blot (WB)
(Western blot analysis of PIK3R4 over-expressed 293 cell line, cotransfected with PIK3R4 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PIK3R4 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)
Western Blot (WB)
(Western blot analysis of PIK3R4 over-expressed 293 cell line, cotransfected with PIK3R4 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PIK3R4 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)
Related Product Information for anti-Pik3r4 antibody
Protein kinases are enzymes that transfer a phosphate group from a phosphate donor, generally the g phosphate of ATP, onto an acceptor amino acid in a substrate protein. By this basic mechanism, protein kinases mediate most of the signal transduction in eukaryotic cells, regulating cellular metabolism, transcription, cell cycle progression, cytoskeletal rearrangement and cell movement, apoptosis, and differentiation. With more than 500 gene products, the protein kinase family is one of the largest families of proteins in eukaryotes. The family has been classified in 8 major groups based on sequence comparison of their tyrosine (PTK) or serine/threonine (STK) kinase catalytic domains.
Product Categories/Family for anti-Pik3r4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
152,447 Da
NCBI Official Full Name
Pik3r4 protein
NCBI Official Synonym Full Names
phosphoinositide-3-kinase, regulatory subunit 4
NCBI Official Symbol
Pik3r4
NCBI Protein Information
phosphoinositide 3-kinase regulatory subunit 4; PI3-kinase regulatory subunit 4; phosphoinositide-3-kinase, regulatory subunit 4, p150
UniProt Protein Name
Phosphoinositide 3-kinase regulatory subunit 4
Protein Family
UniProt Gene Name
Pik3r4
UniProt Synonym Gene Names
PI3-kinase regulatory subunit 4
UniProt Entry Name
PI3R4_RAT
Uniprot Description
PIK3R4: Regulatory subunit of the PI3K complex. May regulate membrane trafficking late in the endocytic pathway. Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.
Protein type: Protein kinase, Ser/Thr (non-receptor); Protein kinase, Other; EC 2.7.11.1; Kinase, lipid; Kinase, protein; Other group; VPS15 family
Cellular Component: membrane; late endosome; nuclear pore; axoneme
Molecular Function: protein serine/threonine kinase activity; ATP binding
Biological Process: macroautophagy; late endosome to vacuole transport; protein targeting to vacuole; peroxisome degradation; protein amino acid phosphorylation
Similar Products
Product Notes
The Pik3r4 pik3r4 (Catalog #AAA6013547) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PIK3R4 (Phosphoinositide 3-kinase Regulatory Subunit 4, PI3-kinase Regulatory Subunit 4, PI3-kinase p150 Subunit, Phosphoinositide 3-kinase Adaptor Protein, MGC102700, p150, VPS15) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PIK3R4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the Pik3r4 pik3r4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: AGSDMKIRFW DLAYPERSYV VAGSTSSPSV SYYRKIIEGT EVVQEIQNKQ KVGPSDDTPR RGPESLPVGH HDIITDVATF QTTQGFIVTA SRDGIVKVWK. It is sometimes possible for the material contained within the vial of "PIK3R4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
