Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunoprecipitation (IP) (Immunoprecipitation of LRRK1 transfected lysate using LRRK1 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with LRRK1 rabbit polyclonal antibody.)

Mouse anti-Human LRRK1 Monoclonal Antibody | anti-LRRK1 antibody

LRRK1 (Leucine-rich Repeat Kinase 1, Leucine-rich Repeat Serine/threonine-protein Kinase 1, FLJ23119, FLJ27465, KIAA1790, RIPK6, Roco1)

Gene Names
LRRK1; RIPK6; Roco1
Reactivity
Human
Applications
ELISA, Immunoprecipitation
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
LRRK1; Monoclonal Antibody; LRRK1 (Leucine-rich Repeat Kinase 1; Leucine-rich Repeat Serine/threonine-protein Kinase 1; FLJ23119; FLJ27465; KIAA1790; RIPK6; Roco1); Anti -LRRK1 (Leucine-rich Repeat Kinase 1; anti-LRRK1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3G8
Specificity
Recognizes human LRRK1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
PGAASDRSEHDLTPMDGETFSQHLQAVKILAVRDLIWVPRRGGDVIVIGLEKDSEAQRGRVIAVLKARELTPHGIMPVSSVKVCWAGWPVRDMVYMAAVM
Applicable Applications for anti-LRRK1 antibody
ELISA (EL/EIA), Immunoprecipitation (IP)
Application Notes
Suitable for use in ELISA and Immunoprecipitation.
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Partial recombinant corresponding to aa560-659 from human LRRK1 (AAH05408) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunoprecipitation (IP)

(Immunoprecipitation of LRRK1 transfected lysate using LRRK1 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with LRRK1 rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of LRRK1 transfected lysate using LRRK1 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with LRRK1 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged LRRK1 is 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged LRRK1 is 0.03ng/ml as a capture antibody.)
Related Product Information for anti-LRRK1 antibody
Protein kinases are enzymes that transfer a phosphate group from a phosphate donor, generally the g phosphate of ATP, onto an acceptor amino acid in a substrate protein. By this basic mechanism, protein kinases mediate most of the signal transduction in eukaryotic cells, regulating cellular metabolism, transcription, cell cycle progression, cytoskeletal rearrangement and cell movement, apoptosis, and differentiation. With more than 500 gene products, the protein kinase family is one of the largest families of proteins in eukaryotes. The family has been classified in 8 major groups based on sequence comparison of their tyrosine (PTK) or serine/threonine (STK) kinase catalytic domains.
Product Categories/Family for anti-LRRK1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
225,393 Da
NCBI Official Full Name
leucine-rich repeat serine/threonine-protein kinase 1
NCBI Official Synonym Full Names
leucine-rich repeat kinase 1
NCBI Official Symbol
LRRK1
NCBI Official Synonym Symbols
RIPK6; Roco1
NCBI Protein Information
leucine-rich repeat serine/threonine-protein kinase 1
UniProt Protein Name
Leucine-rich repeat serine/threonine-protein kinase 1
UniProt Gene Name
LRRK1
UniProt Synonym Gene Names
KIAA1790
UniProt Entry Name
LRRK1_HUMAN

Uniprot Description

Catalytic activity: ATP + a protein = ADP + a phosphoprotein.

Cofactor: Magnesium or manganese.

Enzyme regulation: Binding of GTP stimulates kinase activity. Ref.3

Subunit structure: Homodimer. Ref.6

Subcellular location: Cytoplasm Ref.3.

Sequence similarities: Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. ROCO subfamily.Contains 4 ANK repeats.Contains 13 LRR (leucine-rich) repeats.Contains 1 protein kinase domain.Contains 1 Roc domain.

Sequence caution: The sequence AAY67799.1 differs from that shown. Reason: The cDNA contains a duplication of exon 3.The sequence BAB15547.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.The sequence BAC85472.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Research Articles on LRRK1

Similar Products

Product Notes

The LRRK1 lrrk1 (Catalog #AAA647781) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LRRK1 (Leucine-rich Repeat Kinase 1, Leucine-rich Repeat Serine/threonine-protein Kinase 1, FLJ23119, FLJ27465, KIAA1790, RIPK6, Roco1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LRRK1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Immunoprecipitation (IP). Suitable for use in ELISA and Immunoprecipitation. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the LRRK1 lrrk1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PGAASDRSEH DLTPMDGETF SQHLQAVKIL AVRDLIWVPR RGGDVIVIGL EKDSEAQRGR VIAVLKAREL TPHGIMPVSS VKVCWAGWPV RDMVYMAAVM. It is sometimes possible for the material contained within the vial of "LRRK1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.