Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: RBX2Sample Type: 293T Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human RNF7 Polyclonal Antibody | anti-RNF7 antibody

RNF7 Antibody - N-terminal region

Gene Names
RNF7; SAG; ROC2; rbx2; CKBBP1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
RNF7; Polyclonal Antibody; RNF7 Antibody - N-terminal region; anti-RNF7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDAC
Sequence Length
113
Applicable Applications for anti-RNF7 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human RBX2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: RBX2Sample Type: 293T Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: RBX2Sample Type: 293T Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-RNF7 antibody
This is a rabbit polyclonal antibody against RBX2. It was validated on Western Blot

Target Description: The protein encoded by this gene is a highly conserved ring finger protein. It is an essential subunit of SKP1-cullin/CDC53-F box protein ubiquitin ligases, which are a part of the protein degradation machinery important for cell cycle progression and signal transduction. This protein interacts with, and is a substrate of, casein kinase II (CSNK2A1/CKII). The phosphorylation of this protein by CSNK2A1 has been shown to promote the degradation of IkappaBalpha (CHUK/IKK-alpha/IKBKA) and p27Kip1(CDKN1B). Alternatively spliced transcript variants encoding distinct isoforms have been reported.
Product Categories/Family for anti-RNF7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12kDa
NCBI Official Full Name
RING-box protein 2 isoform 4
NCBI Official Synonym Full Names
ring finger protein 7
NCBI Official Symbol
RNF7
NCBI Official Synonym Symbols
SAG; ROC2; rbx2; CKBBP1
NCBI Protein Information
RING-box protein 2
UniProt Protein Name
RING-box protein 2
Protein Family
UniProt Gene Name
RNF7
UniProt Synonym Gene Names
RBX2; ROC2; SAG; Rbx2; CKBBP1
UniProt Entry Name
RBX2_HUMAN

NCBI Description

The protein encoded by this gene is a highly conserved ring finger protein. It is an essential subunit of SKP1-cullin/CDC53-F box protein ubiquitin ligases, which are a part of the protein degradation machinery important for cell cycle progression and signal transduction. This protein interacts with, and is a substrate of, casein kinase II (CSNK2A1/CKII). The phosphorylation of this protein by CSNK2A1 has been shown to promote the degradation of IkappaBalpha (CHUK/IKK-alpha/IKBKA) and p27Kip1(CDKN1B). Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]

Uniprot Description

RNF7: a highly conserved ring finger protein. An essential subunit of SKP1-cullin/CDC53-F box protein ubiquitin ligases, which are a part of the protein degradation machinery important for cell cycle progression and signal transduction. The RING-type zinc finger recruits the E2 ubiquitination enzyme to the complex and brings it into close proximity to the substrate. This protein interacts with, and is a substrate of, casein kinase II (CKII). The phosphorylation of this protein by CKII has been shown to promote the degradation of IkappaB-alpha (CHUK/IKK-alpha/IKBKA) and p27Kip1(CDKN1B). Two alternatively spliced isoforms have been reported.

Protein type: Ligase; Motility/polarity/chemotaxis; Ubiquitin ligase; Ubiquitin conjugating system; EC 6.3.2.-

Chromosomal Location of Human Ortholog: 3q22-q24

Cellular Component: nucleoplasm; Cul5-RING ubiquitin ligase complex; cytoplasm; nucleus

Molecular Function: protein binding; copper ion binding; zinc ion binding; NEDD8 ligase activity

Biological Process: protein neddylation; protein ubiquitination; response to redox state; induction of apoptosis by oxidative stress; negative regulation of apoptosis

Research Articles on RNF7

Similar Products

Product Notes

The RNF7 rnf7 (Catalog #AAA3219971) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RNF7 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RNF7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RNF7 rnf7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ALASHSGSSG SKSGGDKMFS LKKWNAVAMW SWDVECDTCA ICRVQVMDAC. It is sometimes possible for the material contained within the vial of "RNF7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.