Mouse MMRN1 Monoclonal Antibody | anti-MMRN1 antibody

MMRN1 (Multimerin 1, ECM, EMILIN4, GPIa*, MMRN) (FITC)

Cat. Num. AAA6178241

• Gene Names: MMRN1; ECM; MMRN; GPIa*; EMILIN4
• Applications: Western Blot
• Purity: Purified
• Synonyms: MMRN1; Monoclonal Antibody; MMRN1 (Multimerin 1; ECM; EMILIN4; GPIa*; MMRN) (FITC); Multimerin 1; MMRN; anti-MMRN1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1G10
• Specificity: Recognizes MMRN1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 1228

• Applicable Applications for anti-MMRN1 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: MMRN1 (NP_031377, 291aa-390aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: IHTNQAESHTAVGRGVAEQQQQQGCGDPEVMQKMTDQVNYQAMKLTLLQKKIDNISLTVNDVRNTYSSLEGKVSEDKSREFQSLLKGLKSKSINVLIRDI
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.; ; FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged MMRN1 is 1 ng/ml as a capture antibody.)

Related Product Information for anti-MMRN1 antibody

Multimerin is a massive, soluble protein found in platelets and in the endothelium of blood vessels. It is comprised of subunits linked by interchain disulfide bonds to form large, variably sized homomultimers. Multimerin is a factor V/Va-binding protein and may function as a carrier protein for platelet factor V. It may also have functions as an extracellular matrix or adhesive protein. Recently, patients with an unusual autosomal-dominant bleeding disorder (factor V Quebec) were found to have a deficiency of platelet multimerin. [provided by RefSeq]

Product Categories/Family for anti-MMRN1 antibody

Antibodies; Elastin

NCBI and Uniprot Product Information

• NCBI GI #: 45269141
• NCBI GeneID: 22915
• NCBI Accession #: NP_031377
• NCBI GenBank Nucleotide #: NP_031377.2
• UniProt Accession #: Q13201
• NCBI Official Full Name: multimerin-1
• NCBI Official Synonym Full Names: multimerin 1
• NCBI Official Symbol: MMRN1
• NCBI Official Synonym Symbols: ECM; MMRN; GPIa*; EMILIN4
• NCBI Protein Information: multimerin-1
• UniProt Protein Name: Multimerin-1
• Protein Family: Multimerin
• UniProt Gene Name: MMRN1
• UniProt Synonym Gene Names: ECM; EMILIN4; GPIA*; MMRN; Elastin microfibril interfacer 4; p-155; p155

NCBI Description

Multimerin is a massive, soluble protein found in platelets and in the endothelium of blood vessels. It is comprised of subunits linked by interchain disulfide bonds to form large, variably sized homomultimers. Multimerin is a factor V/Va-binding protein and may function as a carrier protein for platelet factor V. It may also have functions as an extracellular matrix or adhesive protein. Recently, patients with an unusual autosomal-dominant bleeding disorder (factor V Quebec) were found to have a deficiency of platelet multimerin. [provided by RefSeq, Jul 2008]

Uniprot Description

Carrier protein for platelet (but not plasma) factor V/Va. Plays a role in the storage and stabilization of factor V in platelets. Upon release following platelet activation, may limit platelet and plasma factor Va-dependent thrombin generation. Ligand for integrin alpha-IIb/beta-3 and integrin alpha-V/beta-3 on activated platelets, and may function as an extracellular matrix or adhesive protein.