Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

RING-box protein 2 Recombinant Protein | RNF7 recombinant protein

Recombinant Human RING-box protein 2

Gene Names
RNF7; SAG; ROC2; CKBBP1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
RING-box protein 2; Recombinant Human RING-box protein 2; CKII beta-binding protein 1; CKBBP1; RING finger protein 7; Regulator of cullins 2; Sensitive to apoptosis gene protein; RNF7 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-113aa; Full Length
Sequence
ADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK
Sequence Length
113
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for RNF7 recombinant protein
Probable component of the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins involved in cell cycle progression, signal transduction and transcription. Through the RING-type zinc finger, ses to recruit the E2 ubiquitination enzyme to the complex and brings it into close proximity to the substrate. Promotes the neddylation of CUL5 via its interaction with UBE2F. May play a role in protecting cells from apoptosis induced by redox agents.
Product Categories/Family for RNF7 recombinant protein
References
Protein kinase CKII interacts with and phosphorylates the SAG protein containing ring-H2 finger motif.Son M.-Y., Park J.-W., Kim Y.-S., Kang S.-W., Marshak D.R., Park W., Bae Y.-S.Biochem. Biophys. Res. Commun. 263:743-748(1999)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14.6 kDa
NCBI Official Full Name
RING-box protein 2 isoform 4
NCBI Official Synonym Full Names
ring finger protein 7
NCBI Official Symbol
RNF7
NCBI Official Synonym Symbols
SAG; ROC2; CKBBP1
NCBI Protein Information
RING-box protein 2
UniProt Protein Name
RING-box protein 2
Protein Family
UniProt Gene Name
RNF7
UniProt Synonym Gene Names
RBX2; ROC2; SAG; Rbx2; CKBBP1
UniProt Entry Name
RBX2_HUMAN

NCBI Description

The protein encoded by this gene is a highly conserved ring finger protein. It is an essential subunit of SKP1-cullin/CDC53-F box protein ubiquitin ligases, which are a part of the protein degradation machinery important for cell cycle progression and signal transduction. This protein interacts with, and is a substrate of, casein kinase II (CSNK2A1/CKII). The phosphorylation of this protein by CSNK2A1 has been shown to promote the degradation of IkappaBalpha (CHUK/IKK-alpha/IKBKA) and p27Kip1(CDKN1B). Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]

Uniprot Description

RNF7: a highly conserved ring finger protein. An essential subunit of SKP1-cullin/CDC53-F box protein ubiquitin ligases, which are a part of the protein degradation machinery important for cell cycle progression and signal transduction. The RING-type zinc finger recruits the E2 ubiquitination enzyme to the complex and brings it into close proximity to the substrate. This protein interacts with, and is a substrate of, casein kinase II (CKII). The phosphorylation of this protein by CKII has been shown to promote the degradation of IkappaB-alpha (CHUK/IKK-alpha/IKBKA) and p27Kip1(CDKN1B). Two alternatively spliced isoforms have been reported.

Protein type: EC 6.3.2.-; Ligase; Motility/polarity/chemotaxis; Ubiquitin conjugating system; Ubiquitin ligase

Chromosomal Location of Human Ortholog: 3q22-q24

Cellular Component: Cul2-RING ubiquitin ligase complex; Cul5-RING ubiquitin ligase complex; cytoplasm; nucleoplasm

Molecular Function: copper ion binding; NEDD8 ligase activity; protein binding

Biological Process: protein neddylation; protein ubiquitination during ubiquitin-dependent protein catabolic process; response to redox state; SCF-dependent proteasomal ubiquitin-dependent protein catabolic process

Research Articles on RNF7

Similar Products

Product Notes

The RNF7 rnf7 (Catalog #AAA1265476) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-113aa; Full Length. The amino acid sequence is listed below: ADVEDGEETC ALASHSGSSG SKSGGDKMFS LKKWNAVAMW SWDVECDTCA ICRVQVMDAC LRCQAENKQE DCVVVWGECN HSFHNCCMSL WVKQNNRCPL CQQDWVVQRI GK. It is sometimes possible for the material contained within the vial of "RING-box protein 2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.