Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: MouseTarget Name: PPARDSample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

Rabbit PPARD Polyclonal Antibody | anti-PPARD antibody

PPARD antibody - N-terminal region

Gene Names
Ppard; NUC1; NUC-1; Nr1c2; Pparb; PPAR[b]; Pparb/d; PPAR-beta; PPARdelta; PPAR-delta
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
PPARD; Polyclonal Antibody; PPARD antibody - N-terminal region; anti-PPARD antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FGRMPEAEKRKLVAGLTASEGCQHNPQLADLKAFSKHIYNAYLKNFNMTK
Sequence Length
440
Applicable Applications for anti-PPARD antibody
Western Blot (WB)
Homology
Cow: 85%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 93%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of mouse PPARD
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: MouseTarget Name: PPARDSample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: PPARDSample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: PPARDSample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PPARDSample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-PPARD Antibody Titration: 0.3125ug/mlELISA Titer: 1:312500Positive Control: SP2/0 cell lysate)

Western Blot (WB) (WB Suggested Anti-PPARD Antibody Titration: 0.3125ug/mlELISA Titer: 1:312500Positive Control: SP2/0 cell lysate)
Related Product Information for anti-PPARD antibody
This is a rabbit polyclonal antibody against PPARD. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PPARdelta is pivotal to control the program for fatty acid oxidation in the skeletal muscle, thereby ameliorating obesity and insulin resistance through its activation in obese animals.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48kDa
NCBI Official Full Name
peroxisome proliferator-activated receptor delta
NCBI Official Synonym Full Names
peroxisome proliferator activator receptor delta
NCBI Official Symbol
Ppard
NCBI Official Synonym Symbols
NUC1; NUC-1; Nr1c2; Pparb; PPAR[b]; Pparb/d; PPAR-beta; PPARdelta; PPAR-delta
NCBI Protein Information
peroxisome proliferator-activated receptor delta
UniProt Protein Name
Peroxisome proliferator-activated receptor delta
UniProt Gene Name
Ppard
UniProt Synonym Gene Names
Nr1c2; Pparb; PPAR-delta; NUC1; PPAR-beta
UniProt Entry Name
PPARD_MOUSE

Uniprot Description

PPAR-delta: Ligand-activated transcription factor. Receptor that binds peroxisome proliferators such as hypolipidemic drugs and fatty acids. Has a preference for poly-unsaturated fatty acids, such as gamma-linoleic acid and eicosapentanoic acid. Once activated by a ligand, the receptor binds to promoter elements of target genes. Regulates the peroxisomal beta-oxidation pathway of fatty acids. Functions as transcription activator for the acyl-CoA oxidase gene. Decreases expression of NPC1L1 once activated by a ligand. Belongs to the nuclear hormone receptor family. NR1 subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Nuclear receptor; DNA-binding

Cellular Component: nucleus

Molecular Function: ligand-dependent nuclear receptor activity; zinc ion binding; prostacyclin receptor activity; metal ion binding; transcription coactivator activity; enzyme activator activity; drug binding; retinoid X receptor binding; NF-kappaB binding; DNA binding; sequence-specific DNA binding; protein heterodimerization activity; steroid hormone receptor activity; transcription factor activity; lipid binding; fatty acid binding

Biological Process: positive regulation of catalytic activity; transcription from RNA polymerase II promoter; proteoglycan metabolic process; epidermis development; wound healing; regulation of fat cell differentiation; negative regulation of smooth muscle cell proliferation; positive regulation of transcription, DNA-dependent; negative regulation of collagen biosynthetic process; positive regulation of epidermis development; negative regulation of smooth muscle cell migration; negative regulation of transcription from RNA polymerase II promoter; positive regulation of vasodilation; vitamin A metabolic process; regulation of transcription, DNA-dependent; positive regulation of cell proliferation; axon ensheathment; cell differentiation; negative regulation of epithelial cell proliferation; placenta development; intracellular receptor-mediated signaling pathway; transcription, DNA-dependent; positive regulation of insulin secretion; keratinocyte proliferation; cell-substrate adhesion; keratinocyte migration; regulation of cell proliferation; phospholipid biosynthetic process; positive regulation of phosphoinositide 3-kinase cascade; regulation of transcription from RNA polymerase II promoter; cell proliferation; G-protein coupled receptor protein signaling pathway; negative regulation of inflammatory response; mRNA transcription; steroid hormone mediated signaling; fatty acid oxidation; lipid metabolic process; negative regulation of cell growth; anagen; regulation of insulin secretion; cellular process; embryo implantation; negative regulation of apoptosis

Research Articles on PPARD

Similar Products

Product Notes

The PPARD ppard (Catalog #AAA3203804) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PPARD antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PPARD can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PPARD ppard for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FGRMPEAEKR KLVAGLTASE GCQHNPQLAD LKAFSKHIYN AYLKNFNMTK. It is sometimes possible for the material contained within the vial of "PPARD, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.