Western Blot (WB)
(WB Suggested Anti-GATAD2A Antibody Titration: 2.5ug/mlELISA Titer: 1:312500Positive Control: SP2/0 cell lysate)
Rabbit GATAD2A Polyclonal Antibody | anti-GATAD2A antibody
GATAD2A antibody - N-terminal region
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
GATAD2A; Polyclonal Antibody; GATAD2A antibody - N-terminal region; anti-GATAD2A antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MSEEACRTRSQKRTLEPDLTEDDVENKKMKMEKGSSELTVDGDSRVMPEP
Sequence Length
630
Applicable Applications for anti-GATAD2A antibody
Western Blot (WB)
Homology
Human: 91%; Mouse: 100%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of mouse GATAD2A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-GATAD2A Antibody Titration: 2.5ug/mlELISA Titer: 1:312500Positive Control: SP2/0 cell lysate)
Western Blot (WB)
(WB Suggested Anti-GATAD2A Antibody Titration: 2.5ug/mlELISA Titer: 1:312500Positive Control: SP2/0 cell lysate)
Related Product Information for anti-GATAD2A antibody
This is a rabbit polyclonal antibody against GATAD2A. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: GATAD2A's function is not determined.
Target Description: GATAD2A's function is not determined.
Product Categories/Family for anti-GATAD2A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
69kDa
NCBI Official Full Name
transcriptional repressor p66 alpha isoform a
UniProt Protein Name
Transcriptional repressor p66 alpha
Protein Family
UniProt Gene Name
Gatad2a
UniProt Entry Name
P66A_MOUSE
Uniprot Description
GATAD2A: Transcriptional repressor. 2 isoforms of the human protein are produced by alternative splicing.
Cellular Component: nucleoplasm; NuRD complex; nucleus
Molecular Function: protein binding, bridging; metal ion binding
Biological Process: blood vessel development; embryonic body morphogenesis; neural fold formation; transcription, DNA-dependent; anterior neuropore closure; regulation of transcription, DNA-dependent; in utero embryonic development; programmed cell death; negative regulation of transcription, DNA-dependent
Similar Products
Product Notes
The GATAD2A gatad2a (Catalog #AAA3203615) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GATAD2A antibody - N-terminal region reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GATAD2A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GATAD2A gatad2a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MSEEACRTRS QKRTLEPDLT EDDVENKKMK MEKGSSELTV DGDSRVMPEP. It is sometimes possible for the material contained within the vial of "GATAD2A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
