Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: MEF2CSample Tissue: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

Rabbit MEF2C Polyclonal Antibody | anti-MEF2C antibody

MEF2C antibody - N-terminal region

Gene Names
Mef2c; Mef2; AV011172; 5430401D19Rik; 9930028G15Rik
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
MEF2C; Polyclonal Antibody; MEF2C antibody - N-terminal region; anti-MEF2C antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SRTNSDIVEALNKKENKGSESPDPDSSYALTPRTEEKYKKINEEFDNMIK
Sequence Length
432
Applicable Applications for anti-MEF2C antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of mouse MEF2C
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MEF2CSample Tissue: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: MEF2CSample Tissue: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-MEF2C Antibody Titration: 2.5ug/mlELISA Titer: 1:62500Positive Control: SP2/0 cell lysate)

Western Blot (WB) (WB Suggested Anti-MEF2C Antibody Titration: 2.5ug/mlELISA Titer: 1:62500Positive Control: SP2/0 cell lysate)
Related Product Information for anti-MEF2C antibody
This is a rabbit polyclonal antibody against MEF2C. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: MEF2C is a transcription regulator of slow fiber

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48kDa
NCBI Official Full Name
myocyte-specific enhancer factor 2C isoform 2
NCBI Official Synonym Full Names
myocyte enhancer factor 2C
NCBI Official Symbol
Mef2c
NCBI Official Synonym Symbols
Mef2; AV011172; 5430401D19Rik; 9930028G15Rik
NCBI Protein Information
myocyte-specific enhancer factor 2C
UniProt Protein Name
Myocyte-specific enhancer factor 2C
UniProt Gene Name
Mef2c
UniProt Entry Name
MEF2C_MOUSE

Uniprot Description

MEF2C: transcription factor of the MADS family which binds specifically to the MEF2 element present in the regulatory regions of many muscle-specific genes. May be involved in myogenesis, neurogenesis and in the development of cortical architecture. Three splice-variant isoforms have been described.

Protein type: Transcription factor; DNA-binding

Cellular Component: nucleoplasm; sarcomere; protein complex; intracellular membrane-bound organelle; cytoplasm; nuclear speck; intracellular; nucleus; cytosol

Molecular Function: protein dimerization activity; RNA polymerase II transcription factor activity, enhancer binding; protein binding; miRNA binding; transcription activator binding; DNA binding; AT DNA binding; sequence-specific DNA binding; protein heterodimerization activity; histone deacetylase binding; chromatin binding; transcription factor activity

Biological Process: cardiac muscle hypertrophy; multicellular organismal development; positive regulation of transcription, DNA-dependent; heart development; regulation of neurotransmitter secretion; regulation of synaptic plasticity; cardiac muscle cell differentiation; neuron differentiation; positive regulation of MAP kinase activity; B cell receptor signaling pathway; regulation of neuron apoptosis; positive regulation of B cell proliferation; negative regulation of ossification; chondrocyte differentiation; negative regulation of neuron apoptosis; endochondral ossification; positive regulation of cardiac muscle cell proliferation; nervous system development; skeletal muscle development; cell fate commitment; transcription, DNA-dependent; monocyte differentiation; positive regulation of skeletal muscle development; muscle cell fate determination; regulation of synaptogenesis; neuron development; smooth muscle cell differentiation; positive regulation of transcription from RNA polymerase II promoter; B cell proliferation; transcription from RNA polymerase II promoter; regulation of synaptic transmission, glutamatergic; apoptosis; ventricular cardiac muscle cell differentiation; neuron migration; regulation of synaptic activity; palate development; negative regulation of transcription from RNA polymerase II promoter; learning and/or memory; B cell homeostasis; regulation of transcription, DNA-dependent; melanocyte differentiation; regulation of megakaryocyte differentiation; germinal center formation; neural crest cell differentiation; heart looping; cell differentiation; negative regulation of epithelial cell proliferation; blood vessel development; MAPKKK cascade; embryonic viscerocranium morphogenesis; positive regulation of bone mineralization; positive regulation of myoblast differentiation; humoral immune response; regulation of germinal center formation; embryonic skeletal morphogenesis; osteoblast differentiation; positive regulation of osteoblast differentiation; neuron morphogenesis during differentiation; blood vessel remodeling; platelet formation; regulation of excitatory postsynaptic membrane potential; positive regulation of neuron differentiation

Research Articles on MEF2C

Similar Products

Product Notes

The MEF2C mef2c (Catalog #AAA3203548) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MEF2C antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's MEF2C can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MEF2C mef2c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SRTNSDIVEA LNKKENKGSE SPDPDSSYAL TPRTEEKYKK INEEFDNMIK. It is sometimes possible for the material contained within the vial of "MEF2C, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.