Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: MouseTarget Name: TP53Sample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)

Rabbit anti-Mouse, Rat Trp53 Polyclonal Antibody | anti-TRP53 antibody

Trp53 antibody - N-terminal region

Gene Names
Trp53; bbl; bfy; bhy; p44; p53; Tp53
Reactivity
Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Trp53; Polyclonal Antibody; Trp53 antibody - N-terminal region; anti-TRP53 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EEFFEGPSEALRVSGAPAAQDPVTETPGPVAPAPATPWPLSSFVPSQKTY
Sequence Length
390
Applicable Applications for anti-TRP53 antibody
Western Blot (WB)
Homology
Mouse: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: MouseTarget Name: TP53Sample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: TP53Sample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: TP53Sample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TP53Sample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-TRP53 AntibodyPositive Control: Lane 1: 40ug C57/B6 control mouse G.I.Lane 2: 40ug C57/B6 mouse G.I. treated with IrinotecanLane 3: 40ug p53 KO HCT-116 cellsLane 4: 40ug C57/B6 mouse treated with 15 Gy ionizing radiationPrimary Antibody Dilution : 1:1000Secondary Antibody : Goat anti-rabbit-HRPSecondry Antibody Dilution : 1:2500Submitted by: Brian Leibowitz, University of Pittsburgh )

Western Blot (WB) (WB Suggested Anti-TRP53 AntibodyPositive Control: Lane 1: 40ug C57/B6 control mouse G.I.Lane 2: 40ug C57/B6 mouse G.I. treated with IrinotecanLane 3: 40ug p53 KO HCT-116 cellsLane 4: 40ug C57/B6 mouse treated with 15 Gy ionizing radiationPrimary Antibody Dilution : 1:1000Secondary Antibody : Goat anti-rabbit-HRPSecondry Antibody Dilution : 1:2500Submitted by: Brian Leibowitz, University of Pittsburgh )

Western Blot (WB)

(WB Suggested Anti-Trp53 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: SP2/0 cell lysate)

Western Blot (WB) (WB Suggested Anti-Trp53 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: SP2/0 cell lysate)
Related Product Information for anti-TRP53 antibody
This is a rabbit polyclonal antibody against Trp53. It was validated on Western Blot

Target Description: Trp53 is a protein found in elevated levels in a great variety of transformed cells.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
cellular tumor antigen p53 isoform a
NCBI Official Synonym Full Names
transformation related protein 53
NCBI Official Symbol
Trp53
NCBI Official Synonym Symbols
bbl; bfy; bhy; p44; p53; Tp53
NCBI Protein Information
cellular tumor antigen p53

NCBI Description

This gene encodes tumor protein p53, which responds to diverse cellular stresses to regulate target genes that induce cell cycle arrest, apoptosis, senescence, DNA repair, or changes in metabolism. p53 protein is expressed at low level in normal cells and at a high level in a variety of transformed cell lines, where it's believed to contribute to transformation and malignancy. p53 is a DNA-binding protein containing transcription activation, DNA-binding, and oligomerization domains. It is postulated to bind to a p53-binding site and activate expression of downstream genes that inhibit growth and/or invasion, and thus function as a tumor suppressor. Mice deficient for this gene are developmentally normal but are susceptible to spontaneous tumors. Evidence to date shows that this gene contains one promoter, in contrast to alternative promoters of the human gene, and transcribes a few of splice variants which encode different isoforms, although the biological validity or the full-length nature of some variants has not been determined. [provided by RefSeq, Jul 2008]

Research Articles on TRP53

Similar Products

Product Notes

The TRP53 (Catalog #AAA3203809) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Trp53 antibody - N-terminal region reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Trp53 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TRP53 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EEFFEGPSEA LRVSGAPAAQ DPVTETPGPV APAPATPWPL SSFVPSQKTY. It is sometimes possible for the material contained within the vial of "Trp53, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.